Family 11 Carbohydrate-Binding Module from Clostridium thermocellum in complex with beta-1,3-1,4-mixed-linked tetrasaccharide. Determined by X-ray diffraction at 1.45 Å resolution. Released 5 Feb 2020.
Explore 6R3M in 3D Show helices and sheets RCSB PDB PDBe
6R3M contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| β-strand | 7-11 | 5 | 2 |
| β-strand | 20-24 | 5 | 3 |
| β-strand | 28-35 | 8 | 2 |
| β-strand | 40-47 | 8 | 2 |
| β-strand | 53-59 | 7 | 3 |
| β-strand | 70-77 | 8 | 2 |
| β-strand | 85-92 | 8 | 3 |
| α-helix | 93 | 1 | |
| β-strand | 99-107 | 9 | 3 |
| β-strand | 114-119 | 6 | 2 |
| α-helix | 120-122 | 3 | |
| β-strand | 124-125 | 2 | 3 |
| β-strand | 145-152 | 8 | 3 |
| β-strand | 157-168 | 12 | 2 |
| β-strand | 170 | 1 | 1 |
| α-helix | 175-177 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endoglucanase H | A | protein | 178 | Hungateiclostridium thermocellum ATCC 27405 | P16218 (AlphaFold model) |
>6R3M_1 Endoglucanase H (chains A) MASAVGEKMLDDFEGVLNWGSYSGEGAKVSTKIVSGKTGNGMEVSYTGTTDGYWGTVYSL PDGDWSKWLKISFDIKSVDGSANEIRFMIAEKSINGVGDGEHWVYSITPDSSWKTIEIPF SSFRRRLDYQPPGQDMSGTLDLDNIDSIHFMYANNKSGKFVVDNIKLIGALEHHHHHH
Water and common crystallization additives (ACT) are not listed.
Molecular basis for the preferential recognition of beta 1,3-1,4-glucans by the family 11 carbohydrate-binding module from Clostridium thermocellum. Ribeiro, D.O., Viegas, A., Pires, V.M.R. et al. FEBS J (2020) 287:2723-2743. DOI 10.1111/febs.15162 · PubMed
Other PDB entries of the same protein (UniProt P16218 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6R3M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.