6RPR: LEM domain of Emerin mutant T43I

LEM domain of Emerin mutant T43I in complex with BAF dimer and the Igfold of the lamin A/C. Determined by X-ray diffraction at 2.26 Å resolution. Released 4 Mar 2020.

Method: X-ray diffraction
Resolution: 2.26 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,737
Mol. weight: 37.78 kDa
Released: 4 Mar 2020

Explore 6RPR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6RPR contains 16 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	431-436	6	1
β-strand	440-445	6	2
β-strand	451-456	6	2
β-strand	462-463	2	3
β-strand	468-473	6	1
α-helix	477-478	2
β-strand	479-482	4	1
β-strand	488-489	2	3
β-strand	494-499	6	2
α-helix	500-502	3
β-strand	507	1	2
β-strand	511-514	4	2
β-strand	525-531	7	1
β-strand	537-544	8	1

Chains D and E: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	19	1	4
α-helix	20-22	3
α-helix	28-36	9
β-strand	41	1	4
α-helix	42-51	10
α-helix	56-67	12
α-helix	71-88	18

Chain G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
α-helix	31-42	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prelamin-A/C	B	protein	116	Homo sapiens	P02545 (AlphaFold model)
barrier to autointegration factor (BAF)	D, E	protein	87	Homo sapiens	O75531 (AlphaFold model)
LEM domain of emerin mutant T43I	G	protein	43	Homo sapiens	P50402 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>6RPR_1 Prelamin-A/C (chains B)
FSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTL
KAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVR

Sequence of entity 2 (D, E), FASTA

>6RPR_2 barrier to autointegration factor (BAF) (chains D, E)
TSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREW
LKDTAGANAKQSRDAFGALREWADAFL

Sequence of entity 3 (G), FASTA

>6RPR_3 LEM domain of emerin mutant T43I (chains G)
DNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYEIQ

Primary citation

An Emerin LEM-Domain Mutation Impairs Cell Response to Mechanical Stress. Essawy, N., Samson, C., Petitalot, A. et al. Cells (2019) 8. DOI 10.3390/cells8060570 · PubMed

Other PDB entries of the same protein (UniProt P02545 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WZZ 1.3 Å, Crystal structure of peptide KAGQVVTIW in complex with HLA-B5801
7X1B 1.4 Å, Crystal structure of peptide KAGQVVTI in complex with HLA-B5801
1IFR 1.4 Å, Structure of Lamin A/C Globular Domain
3GEF 1.5 Å, Crystal structure of the R482W mutant of lamin A/C
8I33 1.62 Å, Coil 1a of lamin A (residue 25-65)
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
7CRG 1.8 Å, Beta-strand-mediated dimeric formation of the extended Ig-like domains of human lamin A/C
7X5D 1.82 Å, Crystal Structure of the K316C mutant of Human Lamin A/C Coil 2 (residues 244-340)
6YF5 1.83 Å, Lamin A 17-70 coil1A dimer stabilized by C-terminal capping
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
7YVD 2.1 Å, The crystal structure of the progerin C-terminal peptide and the Ig-like domain of lamin…
1X8Y 2.2 Å, Human lamin coil 2B

Browse structure collections

About this viewer

MolViewer shows 6RPR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.