6RQJ: Human complement C5

Structure of human complement C5 complexed with tick inhibitors OmCI, RaCI1 and CirpT1. Determined by electron microscopy at 3.5 Å resolution. Released 8 Jan 2020.

Method: Electron microscopy
Resolution: 3.5 Å
Organisms: Homo sapiens, Rhipicephalus pulchellus
Chains: 5
Atoms: 14,971
Mol. weight: 225.8 kDa
Released: 8 Jan 2020

Explore 6RQJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6RQJ contains 43 α-helices and 152 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 61 β-strands

Element	Residues	Length	Sheet
α-helix	681-689	9
α-helix	696-703	8
α-helix	711-714	4
α-helix	715-717	3
α-helix	721-736	16
α-helix	744-757	14
β-strand	764-765	2	1
α-helix	769-772	4
β-strand	773	1	2
β-strand	777-780	4	3
β-strand	783-789	7	4
β-strand	796-799	4	2
β-strand	802-805	4	3
β-strand	808-811	4	3
α-helix	812-814	3
β-strand	815-818	4	2
β-strand	819	1	5
β-strand	823-827	5	6
β-strand	832-834	3	7
β-strand	838	1	8
β-strand	839-840	2	9
β-strand	843-847	5	6
β-strand	853-859	7	10
β-strand	860	1	11
β-strand	865-867	3	9
β-strand	880	1	11
β-strand	886-888	3	10
β-strand	893-896	4	6
β-strand	899-902	4	9
β-strand	908-916	9	10
β-strand	919-927	9	10
β-strand	928-930	3	7
β-strand	936-944	9	12
β-strand	945	1	13
β-strand	954	1	13
β-strand	956-959	4	14
β-strand	974-980	7	12
α-helix	985-991	7
β-strand	1007	1	15
α-helix	1010-1013	4
α-helix	1016-1028	13
α-helix	1031-1033	3
α-helix	1040-1055	16
α-helix	1057-1059	3
β-strand	1060	1	16
β-strand	1066	1	16
β-strand	1069	1	15
α-helix	1076-1089	14
α-helix	1097-1110	14
α-helix	1133-1155	23
α-helix	1163-1178	16
α-helix	1182	1
α-helix	1185-1196	12
α-helix	1203-1213	11
β-strand	1217-1220	4	17
β-strand	1223-1227	5	17
α-helix	1238-1240	3
α-helix	1245-1260	16
α-helix	1268-1277	10
α-helix	1287-1301	15
α-helix	1305-1308	4
β-strand	1310-1317	8	14
β-strand	1322-1329	8	14
α-helix	1335-1337	3
β-strand	1338-1339	2	12
β-strand	1346-1350	5	14
β-strand	1354	1	14
β-strand	1357-1365	9	12
β-strand	1377-1384	8	18
β-strand	1401-1408	8	18
β-strand	1422-1426	5	19
β-strand	1432-1434	3	20
α-helix	1436-1444	9
β-strand	1452	1	19
β-strand	1461-1463	3	19
β-strand	1475-1478	4	18
β-strand	1479-1481	3	20
β-strand	1486	1	8
α-helix	1488-1490	3
β-strand	1491-1492	2	21
β-strand	1493-1497	5	19
β-strand	1504-1505	2	19
β-strand	1508-1509	2	21
α-helix	1528-1531	4
α-helix	1535-1537	3
α-helix	1547-1552	6
β-strand	1559-1570	12	22
β-strand	1574-1587	14	22
α-helix	1591-1593	3
β-strand	1597-1603	7	22
β-strand	1616-1621	6	22
β-strand	1625-1628	4	22
β-strand	1633-1638	6	22
β-strand	1644-1647	4	22
α-helix	1658-1674	17

Chain B: 5 helices, 62 β-strands

Element	Residues	Length	Sheet
β-strand	22-28	7	28
β-strand	31-32	2	29
β-strand	36-44	9	28
β-strand	50-52	3	30
β-strand	53-57	5	31
β-strand	67-68	2	31
β-strand	71-73	3	30
β-strand	80-86	7	28
α-helix	89-91	3
β-strand	101-107	7	31
β-strand	112-118	7	31
β-strand	119-120	2	29
β-strand	125-130	6	32
β-strand	134-135	2	33
β-strand	140-141	2	34
β-strand	143-148	6	32
β-strand	154	1	32
β-strand	159-161	3	33
β-strand	164	1	33
β-strand	170	1	33
β-strand	174-176	3	33
β-strand	182-184	3	32
α-helix	186-187	2
β-strand	188-189	2	34
β-strand	197-205	9	33
β-strand	212-219	8	33
β-strand	221-222	2	1
β-strand	228-233	6	35
β-strand	238	1	36
β-strand	247-253	7	35
β-strand	259	1	35
β-strand	262-272	11	35
β-strand	280-282	3	35
β-strand	289-293	5	35
β-strand	296-300	5	35
α-helix	303-306	4
β-strand	322-331	10	35
β-strand	337-342	6	35
β-strand	346	1	35
β-strand	347	1	36
β-strand	353-356	4	37
β-strand	362-363	2	38
β-strand	369-376	8	37
β-strand	382	1	37
β-strand	387-396	10	38
β-strand	402-410	9	38
β-strand	417-422	6	37
β-strand	428-437	10	38
β-strand	449-451	3	38
β-strand	454-456	3	38
β-strand	464-468	5	39
β-strand	481-489	9	39
α-helix	493-495	3
β-strand	498	1	40
β-strand	502-505	4	41
β-strand	508-509	2	41
β-strand	516	1	40
β-strand	524-529	6	39
β-strand	537-546	10	41
β-strand	553-562	10	41
β-strand	572-576	5	4
β-strand	582	1	5
β-strand	587-593	7	4
β-strand	598-601	4	3
β-strand	604-606	3	2
α-helix	642-649	8
β-strand	651-654	4	28

Chain C: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	34-39	6
β-strand	43-48	6	23
α-helix	53-54	2
β-strand	55-61	7	23
β-strand	66	1	24
β-strand	69	1	24
β-strand	70-77	8	23
β-strand	78	1	25
β-strand	81	1	25
β-strand	84-92	9	23
β-strand	95-100	6	23
β-strand	103-112	10	23
β-strand	118-123	6	23
β-strand	129-135	7	23
β-strand	139-140	2	17
α-helix	141-155	15
β-strand	161	1	23

Chain D: 0 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	20-23	4	26
β-strand	29-31	3	26
β-strand	38-41	4	27
β-strand	51-52	2	26
β-strand	54-57	4	27

Chain E: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	42
β-strand	16-17	2	43
β-strand	20-23	4	43
β-strand	26-28	3	43
β-strand	34-35	2	42
β-strand	42-46	5	42
β-strand	51-55	5	42
α-helix	57-59	3
β-strand	60-61	2	37
β-strand	67-69	3	44
β-strand	82-84	3	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A	protein	999	Homo sapiens	P01031 (AlphaFold model)
Complement inhibitor	C	protein	165	Rhipicephalus pulchellus	Q5YD59 (AlphaFold model)
Rhipicephalus appendiculatus RaCI1	D	protein	81	Rhipicephalus pulchellus	A0A141SFN4 (AlphaFold model)
Complement C5	B	protein	655	Homo sapiens	P01031 (AlphaFold model)
Putative 8.9 kDa family member	E	protein	112	Rhipicephalus pulchellus	L7MB58 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6RQJ_1 Complement C5 (chains A)
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQ
LRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTW
EIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCV
KMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETW
FGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRIL
SVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSD
PLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQ
NSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFD
ICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREAL
VKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEE
QRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRP
VEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNS
DYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKD
GHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQ
KVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKY
KATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIY
PLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 2 (C), FASTA

>6RQJ_2 Complement inhibitor (chains C)
MASHHHHHHHHHHSGDSESDCTGSEPVDAFQAFSEGKEAYVLVRSTDPKARDCLKGEPAG
EKQDNTLPVMMTFKQGTDWASTDWTFTLDGAKVTATLGQLTQNREVVYDSQSHHCHVDKV
EKEVPDYEMWMLDAGGLEVEVECCRQKLEELASGRNQMYPHLKDC

Sequence of entity 3 (D), FASTA

>6RQJ_3 Rhipicephalus appendiculatus RaCI1 (chains D)
GPMEEVKTTPIPNHQCVNATCERKLDALGNAVITKCPQGCLCVVRGASNIVPANGTCFQL
ATTKPPMAPGDNKDNKEEESN

Sequence of entity 4 (B), FASTA

>6RQJ_4 Complement C5 (chains B)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEIL

Sequence of entity 5 (E), FASTA

>6RQJ_5 Putative 8.9 kDa family member (chains E)
KHHHHHHSAGLEVLFQGPMGDVQERGHTYVTKNVTVEDGACVYLRNVIPNGETKALNNPC
VLSTCYAADRKVNSTLCPNIGVDEGCHVEWTPDGVYPNCCPKHVCPSATASS

Primary citation

An inhibitor of complement C5 provides structural insights into activation. Reichhardt, M.P., Johnson, S., Tang, T. et al. Proc Natl Acad Sci U S A (2020) 117:362-370. DOI 10.1073/pnas.1909973116 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 6RQJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.