6S1R: Fission yeast Mis16

Structure of fission yeast Mis16 bound to histone H4. Determined by X-ray diffraction at 1.8 Å resolution. Released 7 Aug 2019.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Schizosaccharomyces pombe
Chains: 2
Atoms: 3,480
Mol. weight: 51.88 kDa
Released: 7 Aug 2019

Explore 6S1R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6S1R contains 10 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	13-40	28
β-strand	41-48	8	1
β-strand	56-64	9	2
β-strand	70-77	8	2
α-helix	86	1
β-strand	87-97	11	2
β-strand	122-130	9	2
β-strand	136-140	5	3
β-strand	143-150	8	3
α-helix	152-154	3
β-strand	156-160	5	3
α-helix	171-174	4
β-strand	176-178	3	3
β-strand	185-190	6	4
β-strand	197-202	6	4
β-strand	207-211	5	4
α-helix	214-216	3
α-helix	222	1
β-strand	223-225	3	3
β-strand	229-231	3	4
β-strand	238-243	6	5
β-strand	250-255	6	5
β-strand	260-264	5	5
β-strand	275-277	3	5
β-strand	284-289	6	6
β-strand	296-301	6	6
β-strand	306-310	5	6
β-strand	317-321	5	6
β-strand	328-333	6	7
β-strand	340-345	6	7
β-strand	350-354	5	7
α-helix	355-357	3
α-helix	364-369	6
β-strand	374-378	5	7
β-strand	385-390	6	1
β-strand	398-402	5	1
β-strand	406-412	7	1
α-helix	414-417	4

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	32-40	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase type B subunit 2	A	protein	430	Schizosaccharomyces pombe	O94244 (AlphaFold model)
Histone H4	B	protein	31	Schizosaccharomyces pombe	P09322 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6S1R_1 Histone acetyltransferase type B subunit 2 (chains A)
GSEEVVQDAPLENNELNAEIDLQKTIQEEYKLWKQNVPFLYDLVITHALEWPSLTIQWLP
DKKTIPGTDYSIQRLILGTHTSGNDQNYLQIASVQLPNFDEDTTEFTPSTIRRAQATGSY
TIEISQKIPHDGDVNRARYMPQKPEIIATMGEGGNAYIFDTTCHDALTTGEALPQAVLKG
HTAEGFGLCWNPNLPGNLATGAEDQVICLWDVQTQSFTSSETKVISPIAKYHRHTDIVND
VQFHPQHEALLASVSDDCTLQIHDTRLNPEEEAPKVIQAHSKAINAVAINPFNDYLLATA
SADKTVALWDLRNPYQRLHTLEGHEDEVYGLEWSPHDEPILASSSTDRRVCIWDLEKIGE
EQTPEDAEDGSPELLFMHGGHTNRISEFSWCPNERWVVGSLADDNILQIWSPSRVIWGRD
HVQVSPRDLE

Sequence of entity 2 (B), FASTA

>6S1R_2 Histone H4 (chains B)
GGAKRHRKILRDNIQGITKPAIRRLARRGGV

Primary citation

Subunit interactions and arrangements in the fission yeast Mis16-Mis18-Mis19 complex. Korntner-Vetter, M., Lefevre, S., Hu, X.W. et al. Life Sci Alliance (2019) 2. DOI 10.26508/lsa.201900408 · PubMed

Other PDB entries of the same protein (UniProt O94244 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S1L 1.94 Å, Structure of fission yeast Mis16
6S29 1.99 Å, Structure of fission yeast Mis16-Mis19 complex
5WJC 2.3 Å, Crystal structure of Schizosaccharomyces pombe Mis16 in complex with Eic1

Browse structure collections

About this viewer

MolViewer shows 6S1R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.