6S29: Fission yeast Mis16-Mis19 complex

Structure of fission yeast Mis16-Mis19 complex. Determined by X-ray diffraction at 1.99 Å resolution. Released 7 Aug 2019.

Method: X-ray diffraction
Resolution: 1.99 Å
Organisms: Schizosaccharomyces pombe, Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 4
Atoms: 7,945
Mol. weight: 111.97 kDa
Released: 7 Aug 2019

Explore 6S29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6S29 contains 25 α-helices and 65 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	16-36	21
α-helix	37-39	3
β-strand	41-48	8	1
β-strand	56-64	9	2
β-strand	70-77	8	2
α-helix	86	1
β-strand	87-97	11	2
β-strand	100	1	3
α-helix	112-114	3
β-strand	122-130	9	2
β-strand	136-140	5	4
β-strand	143-150	8	4
α-helix	152-154	3
β-strand	156-160	5	4
β-strand	176-178	3	4
β-strand	187-190	4	5
β-strand	197-201	5	5
β-strand	207-211	5	5
α-helix	214-216	3
β-strand	223-225	3	4
β-strand	229-231	3	5
β-strand	238-244	7	6
β-strand	247-255	9	6
β-strand	260-264	5	6
α-helix	272-273	2
β-strand	275-277	3	6
β-strand	284-289	6	7
β-strand	296-301	6	7
β-strand	305-310	6	7
β-strand	313	1	7
β-strand	319-322	4	7
β-strand	328-333	6	8
β-strand	340-345	6	8
β-strand	350-354	5	8
α-helix	355-357	3
α-helix	364-367	4
β-strand	374-378	5	8
β-strand	385-390	6	1
β-strand	398-402	5	1
β-strand	406-412	7	1
α-helix	414-417	4

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	58-62	5	1
β-strand	65	1	3
α-helix	75-78	4
α-helix	79-97	19
α-helix	104-111	8

Chain C: 9 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	16-36	21
α-helix	37-39	3
β-strand	41-48	8	9
β-strand	56-64	9	10
β-strand	70-78	9	10
α-helix	86	1
β-strand	87-97	11	10
β-strand	100	1	11
α-helix	112-114	3
β-strand	122-130	9	10
β-strand	136-140	5	12
β-strand	143-150	8	12
α-helix	152-154	3
β-strand	156-160	5	12
β-strand	176-178	3	12
β-strand	185-190	6	13
β-strand	197-202	6	13
β-strand	207-211	5	13
β-strand	223-225	3	12
β-strand	229-231	3	13
β-strand	238-243	6	14
β-strand	250-255	6	14
β-strand	260-264	5	14
α-helix	272-273	2
β-strand	275-277	3	14
β-strand	284-289	6	15
β-strand	296-301	6	15
β-strand	306-310	5	15
β-strand	319-321	3	15
β-strand	328-333	6	16
β-strand	340-345	6	16
β-strand	350-354	5	16
α-helix	355-357	3
α-helix	364-367	4
β-strand	374-378	5	16
β-strand	385-390	6	9
β-strand	398-402	5	9
β-strand	406-412	7	9
α-helix	414-417	4

Chain D: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	57-62	6	9
β-strand	65	1	11
α-helix	75-78	4
α-helix	79-96	18
α-helix	104-111	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase type B subunit 2	A, C	protein	430	Schizosaccharomyces pombe	O94244 (AlphaFold model)
CENP-A recruiting complex protein mis19	B, D	protein	61	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	O42995 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6S29_1 Histone acetyltransferase type B subunit 2 (chains A, C)
GSEEVVQDAPLENNELNAEIDLQKTIQEEYKLWKQNVPFLYDLVITHALEWPSLTIQWLP
DKKTIPGTDYSIQRLILGTHTSGNDQNYLQIASVQLPNFDEDTTEFTPSTIRRAQATGSY
TIEISQKIPHDGDVNRARYMPQKPEIIATMGEGGNAYIFDTTCHDALTTGEALPQAVLKG
HTAEGFGLCWNPNLPGNLATGAEDQVICLWDVQTQSFTSSETKVISPIAKYHRHTDIVND
VQFHPQHEALLASVSDDCTLQIHDTRLNPEEEAPKVIQAHSKAINAVAINPFNDYLLATA
SADKTVALWDLRNPYQRLHTLEGHEDEVYGLEWSPHDEPILASSSTDRRVCIWDLEKIGE
EQTPEDAEDGSPELLFMHGGHTNRISEFSWCPNERWVVGSLADDNILQIWSPSRVIWGRD
HVQVSPRDLE

Sequence of entity 2 (B, D), FASTA

>6S29_2 CENP-A recruiting complex protein mis19 (chains B, D)
PRVYETELLVLRFREFGVKDNHNHPINLHSLRSKSLIRAQGKKLDLHNRVFLRRNVRAVK
M

Primary citation

Subunit interactions and arrangements in the fission yeast Mis16-Mis18-Mis19 complex. Korntner-Vetter, M., Lefevre, S., Hu, X.W. et al. Life Sci Alliance (2019) 2. DOI 10.26508/lsa.201900408 · PubMed

Other PDB entries of the same protein (UniProt O94244 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S1R 1.8 Å, Structure of fission yeast Mis16 bound to histone H4
6S1L 1.94 Å, Structure of fission yeast Mis16
5WJC 2.3 Å, Crystal structure of Schizosaccharomyces pombe Mis16 in complex with Eic1

Browse structure collections

About this viewer

MolViewer shows 6S29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.