Crystal structure of Schizosaccharomyces pombe Mis16 in complex with Eic1. Determined by X-ray diffraction at 2.3 Å resolution. Released 27 Jun 2018.
Explore 5WJC in 3D Show helices and sheets RCSB PDB PDBe
5WJC contains 10 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-36 | 21 | |
| α-helix | 37-39 | 3 | |
| β-strand | 41-48 | 8 | 1 |
| β-strand | 56-64 | 9 | 2 |
| β-strand | 70-78 | 9 | 2 |
| β-strand | 87-97 | 11 | 2 |
| β-strand | 122-130 | 9 | 2 |
| β-strand | 136-140 | 5 | 3 |
| β-strand | 143-150 | 8 | 3 |
| α-helix | 152-154 | 3 | |
| β-strand | 156-160 | 5 | 3 |
| α-helix | 161-163 | 3 | |
| β-strand | 176-178 | 3 | 3 |
| β-strand | 185-190 | 6 | 4 |
| β-strand | 197-202 | 6 | 4 |
| β-strand | 207-211 | 5 | 4 |
| α-helix | 214-216 | 3 | |
| β-strand | 223-225 | 3 | 3 |
| β-strand | 229-231 | 3 | 4 |
| β-strand | 238-243 | 6 | 5 |
| β-strand | 250-255 | 6 | 5 |
| β-strand | 260-264 | 5 | 5 |
| α-helix | 272-273 | 2 | |
| β-strand | 275-277 | 3 | 5 |
| β-strand | 284-289 | 6 | 6 |
| β-strand | 296-301 | 6 | 6 |
| β-strand | 305-310 | 6 | 6 |
| β-strand | 319-322 | 4 | 6 |
| β-strand | 328-333 | 6 | 7 |
| β-strand | 340-345 | 6 | 7 |
| β-strand | 350-354 | 5 | 7 |
| α-helix | 355-357 | 3 | |
| α-helix | 364-367 | 4 | |
| β-strand | 374-378 | 5 | 7 |
| β-strand | 385-390 | 6 | 1 |
| β-strand | 398-402 | 5 | 1 |
| β-strand | 406-412 | 7 | 1 |
| α-helix | 414-417 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-14 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kinetochore protein Mis16 | A | protein | 430 | Schizosaccharomyces pombe 972h- | O94244 (AlphaFold model) |
| Eic1 protein | B | protein | 112 | Schizosaccharomyces pombe 972h- | O42995 (AlphaFold model) |
>5WJC_1 Kinetochore protein Mis16 (chains A) MSEEVVQDAPLENNELNAEIDLQKTIQEEYKLWKQNVPFLYDLVITHALEWPSLTIQWLP DKKTIPGTDYSIQRLILGTHTSGNDQNYLQIASVQLPNFDEDTTEFTPSTIRRAQATGSY TIEISQKIPHDGDVNRARYMPQKPEIIATMGEGGNAYIFDTTCHDALTTGEALPQAVLKG HTAEGFGLCWNPNLPGNLATGAEDQVICLWDVQTQSFTSSETKVISPIAKYHRHTDIVND VQFHPQHEALLASVSDDCTLQIHDTRLNPEEEAPKVIQAHSKAINAVAINPFNDYLLATA SADKTVALWDLRNPYQRLHTLEGHEDEVYGLEWSPHDEPILASSSTDRRVCIWDLEKIGE EQTPEDAEDGSPELLFMHGGHTNRISEFSWCPNERWVVGSLADDNILQIWSPSRVIWGRD HVQVSPRDLE
>5WJC_2 Eic1 protein (chains B) MDLMPLEKARAIEIAFDNVFHNTKIPDNLQQFDAILKRLERRRFIPTENQKPRVYETELL VLRFREFGVKDNHNHPINLHSLRSKSLIRAQGKKLDLHNRVFLRRNVRAVKM
Mis16 Switches Function from a Histone H4 Chaperone to a CENP-ACnp1-Specific Assembly Factor through Eic1 Interaction. An, S., Koldewey, P., Chik, J. et al. Structure (2018) 26:960. DOI 10.1016/j.str.2018.04.012 · PubMed
Other PDB entries of the same protein (UniProt O94244 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5WJC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.