6SAD: 14-3-3 gamma

Structure of 14-3-3 gamma in complex with double phosphorylated caspase-2 peptide on Ser139 and Ser164. Determined by X-ray diffraction at 2.75 Å resolution. Released 22 Jan 2020.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,808
Mol. weight: 58.1 kDa
Released: 22 Jan 2020

Explore 6SAD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SAD contains 25 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-32	13
α-helix	35-37	3
α-helix	39-70	32
α-helix	78-103	26
α-helix	104-108	5
α-helix	117-135	19
α-helix	141-164	24
α-helix	170-185	16
α-helix	190-205	16
α-helix	208-210	3
α-helix	214-232	19

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-16	13
α-helix	20-31	12
α-helix	35-38	4
α-helix	39-69	31
α-helix	76-103	28
α-helix	104-108	5
α-helix	117-136	20
α-helix	141-164	24
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-206	17
α-helix	208-210	3
α-helix	216-232	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein gamma	A, B	protein	234	Homo sapiens	P61981 (AlphaFold model)
Caspase-2	C	protein	34	Homo sapiens	P42575 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6SAD_1 14-3-3 protein gamma (chains A, B)
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWT

Sequence of entity 2 (C), FASTA

>6SAD_2 Caspase-2 (chains C)
DYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNK

Primary citation

14-3-3 protein binding blocks the dimerization interface of caspase-2. Kalabova, D., Filandr, F., Alblova, M. et al. FEBS J (2020) 287:3494-3510. DOI 10.1111/febs.15215 · PubMed

Other PDB entries of the same protein (UniProt P61981 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S9K 1.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 peptide containing 14-3-3 binding…
6ZBT 1.8 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser342
3UZD 1.86 Å, Crystal structure of 14-3-3 GAMMA
6ZC9 1.9 Å, Structure of 14-3-3 gamma in complex with Nedd4-2 14-3-3 binding motif Ser448
6A5S 2.1 Å, Structure of 14-3-3 gamma in complex with TFEB 14-3-3 binding motif
4E2E 2.25 Å, Crystal structure of a tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation…
7A6Y 2.5 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide stabilized by FC-A
2B05 2.55 Å, Crystal Structure of 14-3-3 gamma in complex with a phosphoserine peptide
6GKF 2.6 Å, Structure of 14-3-3 gamma in complex with caspase-2 14-3-3 binding motif Ser139
6BZD 2.67 Å, Structure of 14-3-3 gamma R57E mutant bound to GlcNAcylated peptide
7A6R 2.7 Å, Structure of 14-3-3 gamma in complex with DAPK2 peptide containing the 14-3-3 binding…
5D3E 2.75 Å, Crystal structure of human 14-3-3 gamma in complex with CFTR R-domain peptide pS768-pS795

Browse structure collections

About this viewer

MolViewer shows 6SAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.