6SMC: Interleukin-12 subunit beta

mouse Interleukin-12 subunit beta - p80 homodimer in space group P1. Determined by X-ray diffraction at 3.5 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Mus musculus
Chains: 4
Atoms: 9,784
Mol. weight: 160.66 kDa
Released: 9 Sept 2020

Explore 6SMC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SMC contains 28 α-helices and 119 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	30-36	7	1
β-strand	44-49	6	2
β-strand	59-61	3	1
β-strand	68-71	4	1
β-strand	74-79	6	2
α-helix	82-84	3
β-strand	86-91	6	1
β-strand	92	1	3
β-strand	95	1	3
β-strand	99-108	10	1
β-strand	111-112	2	1
β-strand	117-118	2	4
α-helix	119	1
β-strand	127-129	3	4
β-strand	130	1	5
β-strand	136-143	8	4
β-strand	149-155	7	1
β-strand	165-167	3	4
β-strand	171-179	9	4
β-strand	182-193	12	4
α-helix	201-202	2
β-strand	206-214	9	1
β-strand	217-225	9	1
α-helix	227-230	4
β-strand	231	1	5
α-helix	233-236	4
β-strand	237-243	7	6
β-strand	249-254	6	6
α-helix	267	1
β-strand	268-275	8	7
β-strand	294-296	3	7
β-strand	300-303	4	6
β-strand	309-316	8	7
α-helix	321-326	6
β-strand	327-330	4	7

Chain B: 7 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	8
β-strand	30-34	5	8
β-strand	44-49	6	9
β-strand	59-62	4	8
β-strand	68-71	4	8
β-strand	74-79	6	9
α-helix	82-84	3
β-strand	86-91	6	8
β-strand	92	1	10
β-strand	95	1	10
β-strand	99-105	7	8
β-strand	107-108	2	11
β-strand	111-112	2	11
β-strand	117-118	2	12
α-helix	119	1
β-strand	127-129	3	12
β-strand	130	1	13
β-strand	136-143	8	12
β-strand	149-155	7	8
β-strand	165-179	15	12
β-strand	182-193	12	12
α-helix	201-202	2
β-strand	206-214	9	8
β-strand	217-225	9	8
α-helix	227-230	4
β-strand	231	1	13
α-helix	233-236	4
β-strand	237-243	7	14
β-strand	249-254	6	14
α-helix	267	1
β-strand	268-275	8	15
β-strand	294-296	3	15
β-strand	300-303	4	14
β-strand	309-316	8	15
α-helix	321-326	6
β-strand	327-330	4	15

Chain C: 7 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	16
β-strand	30-36	7	16
β-strand	44-49	6	17
β-strand	59-61	3	16
β-strand	68-71	4	16
β-strand	74-79	6	17
α-helix	82-84	3
β-strand	86-91	6	16
β-strand	92	1	18
β-strand	95	1	18
β-strand	99-108	10	16
β-strand	111-112	2	16
β-strand	117-118	2	19
α-helix	119	1
β-strand	127-129	3	19
β-strand	130	1	20
β-strand	136-143	8	19
β-strand	150-155	6	21
β-strand	165-172	8	19
β-strand	177-178	2	22
β-strand	183-184	2	22
β-strand	185-193	9	19
α-helix	201-202	2
β-strand	206-213	8	21
β-strand	217	1	16
β-strand	218-225	8	21
α-helix	227-229	3
β-strand	231	1	20
α-helix	233-236	4
β-strand	237-243	7	23
β-strand	249-254	6	23
α-helix	267	1
β-strand	268-275	8	24
β-strand	294-296	3	24
β-strand	300-303	4	23
β-strand	309-316	8	24
α-helix	321-326	6
β-strand	327-330	4	24

Chain D: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	25
β-strand	30-34	5	25
β-strand	44-49	6	26
β-strand	59-61	3	25
β-strand	68-71	4	25
β-strand	74-79	6	26
α-helix	82-84	3
β-strand	86-91	6	25
β-strand	99-105	7	25
β-strand	107-108	2	27
β-strand	111-112	2	27
β-strand	117-118	2	28
α-helix	119	1
β-strand	127-129	3	28
β-strand	130	1	29
β-strand	136-143	8	28
β-strand	149-155	7	25
β-strand	165-167	3	28
β-strand	171-172	2	28
β-strand	177-179	3	30
β-strand	182-184	3	30
β-strand	185-193	9	28
α-helix	201-202	2
β-strand	206-214	9	25
β-strand	217-225	9	25
α-helix	227-230	4
β-strand	231	1	29
α-helix	233-236	4
β-strand	237-243	7	31
β-strand	249-254	6	31
α-helix	267	1
β-strand	268-275	8	32
β-strand	294-296	3	32
β-strand	300-303	4	31
β-strand	309-316	8	32
α-helix	321-326	6
β-strand	327-330	4	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A, B, C, D	protein	344	Mus musculus	P43432 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6SMC_1 Interleukin-12 subunit beta (chains A, B, C, D)
MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW
TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD
QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ
MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS
TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRSGTKHHHHHH

Primary citation

Around she goes: the structure of mouse Interleukin-12 p80. Bloch, Y., Savvides, S.N. To be published.

Other PDB entries of the same protein (UniProt P43432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CR5 2.15 Å, Murine Interleukin-12 receptor beta 1 domain 1 in complex with murine Interleukin-12 beta.
6SFF 2.4 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group I41
8CR6 2.85 Å, mouse Interleukin-12
6SP3 3.0 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 1
7R3N 3.16 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 3
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8ODZ 3.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
7PUR 3.9 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 2
8OE0 4.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…

Browse structure collections

About this viewer

MolViewer shows 6SMC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.