7R3N: Interleukin-12 subunit beta

mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 3. Determined by X-ray diffraction at 3.16 Å resolution. Released 4 May 2022.

Method: X-ray diffraction
Resolution: 3.16 Å
Organism: Mus musculus
Chains: 4
Atoms: 9,888
Mol. weight: 156.44 kDa
Ligands: PO4
Released: 4 May 2022

Explore 7R3N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7R3N contains 24 α-helices and 116 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	1
β-strand	30-36	7	1
α-helix	41-43	3
β-strand	44-49	6	2
β-strand	59-62	4	1
β-strand	65-71	7	1
β-strand	74-79	6	2
α-helix	82-84	3
β-strand	86-92	7	1
β-strand	95-108	14	1
β-strand	111-112	2	1
β-strand	117-118	2	3
β-strand	127-129	3	3
β-strand	130	1	4
β-strand	136-143	8	3
β-strand	149-155	7	1
β-strand	165-167	3	3
β-strand	171-172	2	3
β-strand	177-179	3	5
β-strand	182-184	3	5
β-strand	185-193	9	3
β-strand	206-214	9	1
β-strand	217-225	9	1
α-helix	227-230	4
β-strand	231	1	4
α-helix	233-236	4
β-strand	237-243	7	6
α-helix	245-247	3
β-strand	249-254	6	6
β-strand	268-275	8	7
β-strand	294-296	3	7
β-strand	300-303	4	6
β-strand	308-316	9	7
α-helix	322-326	5
β-strand	327-331	5	7

Chain B: 6 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	8
β-strand	30-36	7	8
α-helix	41-43	3
β-strand	44-49	6	9
β-strand	59-62	4	8
β-strand	70-71	2	8
β-strand	74-79	6	9
α-helix	82-84	3
β-strand	86-92	7	8
β-strand	95-108	14	8
β-strand	111-112	2	8
β-strand	117-118	2	10
β-strand	127-129	3	10
β-strand	130	1	11
β-strand	136-143	8	10
β-strand	149-155	7	8
β-strand	165-167	3	10
β-strand	171-172	2	10
β-strand	177-179	3	12
β-strand	182-184	3	12
β-strand	185-193	9	10
β-strand	206-214	9	8
β-strand	217-225	9	8
α-helix	227-229	3
β-strand	231	1	11
α-helix	233-236	4
β-strand	237-243	7	13
α-helix	245-247	3
β-strand	249-254	6	13
β-strand	268-275	8	14
β-strand	294-296	3	14
β-strand	300-303	4	13
β-strand	309-316	8	14
α-helix	322-326	5
β-strand	327-330	4	14

Chain C: 5 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	15
β-strand	30-36	7	15
α-helix	41-43	3
β-strand	44-49	6	16
β-strand	59-62	4	15
β-strand	65-71	7	15
β-strand	74-79	6	16
α-helix	82-84	3
β-strand	86-92	7	15
β-strand	95-108	14	15
β-strand	111-112	2	15
β-strand	117-118	2	17
β-strand	127-129	3	17
β-strand	130	1	18
β-strand	136-143	8	17
β-strand	149-155	7	15
β-strand	165-167	3	17
β-strand	171-172	2	17
β-strand	177-179	3	19
β-strand	182-184	3	19
β-strand	185-193	9	17
β-strand	206-214	9	15
β-strand	217-225	9	15
α-helix	227-229	3
β-strand	231	1	18
α-helix	233-236	4
β-strand	237-243	7	20
β-strand	249-254	6	20
β-strand	268-275	8	21
β-strand	294-296	3	21
β-strand	300-303	4	20
β-strand	308-316	9	21
α-helix	321-326	6
β-strand	327-331	5	21

Chain D: 7 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	24-27	4	22
β-strand	30-36	7	22
α-helix	41-43	3
β-strand	44-49	6	23
β-strand	59-62	4	22
β-strand	65-71	7	22
β-strand	74-79	6	23
α-helix	82-84	3
β-strand	86-92	7	22
β-strand	95-108	14	22
β-strand	111-112	2	22
β-strand	117-118	2	24
α-helix	119	1
β-strand	127-129	3	24
β-strand	130	1	25
β-strand	136-143	8	24
β-strand	149-155	7	22
β-strand	165-167	3	24
β-strand	171-172	2	24
β-strand	177-179	3	26
β-strand	182-184	3	26
β-strand	185-193	9	24
β-strand	206-214	9	22
β-strand	217-225	9	22
α-helix	227-230	4
β-strand	231	1	25
α-helix	233-236	4
β-strand	237-243	7	27
α-helix	245-247	3
β-strand	249-254	6	27
β-strand	268-275	8	28
β-strand	294-296	3	28
β-strand	300-303	4	27
β-strand	309-316	8	28
α-helix	321-326	6
β-strand	327-330	4	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 subunit beta	A, B, C, D	protein	335	Mus musculus	P43432 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7R3N_1 Interleukin-12 subunit beta (chains A, B, C, D)
MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITW
TSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNF
KNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLD
QRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQ
MKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTS
TEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	5

Primary citation

Around she goes: the structure of mouse Interleukin-12 p80. Bloch, Y., Savvides, S.N. To be published.

Other PDB entries of the same protein (UniProt P43432 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CR5 2.15 Å, Murine Interleukin-12 receptor beta 1 domain 1 in complex with murine Interleukin-12 beta.
6SFF 2.4 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group I41
8CR6 2.85 Å, mouse Interleukin-12
6SP3 3.0 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 1
6SMC 3.5 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P1
8PB1 3.5 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
8ODZ 3.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…
7PUR 3.9 Å, mouse Interleukin-12 subunit beta - p80 homodimer in space group P21 crystal form 2
8OE0 4.6 Å, Cryo-EM structure of a pre-dimerized murine IL-12 complete extracellular signaling…

Browse structure collections

About this viewer

MolViewer shows 7R3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.