Crystal structure of RTX domain blocks IV and V of adenylate cyclase toxin from Bordetella pertussis. Determined by X-ray diffraction at 1.76 Å resolution. Released 16 Sept 2020.
Explore 6SUS in 3D Show helices and sheets RCSB PDB PDBe
6SUS contains 3 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1411 | 1 | 1 |
| β-strand | 1418-1420 | 3 | 2 |
| β-strand | 1427-1429 | 3 | 1 |
| β-strand | 1436-1438 | 3 | 2 |
| β-strand | 1445-1447 | 3 | 1 |
| β-strand | 1454-1456 | 3 | 2 |
| β-strand | 1463-1465 | 3 | 1 |
| β-strand | 1474-1476 | 3 | 2 |
| β-strand | 1483-1485 | 3 | 1 |
| β-strand | 1500-1503 | 4 | 2 |
| β-strand | 1508-1511 | 4 | 2 |
| β-strand | 1514-1522 | 9 | 2 |
| β-strand | 1526-1528 | 3 | 1 |
| β-strand | 1535-1537 | 3 | 2 |
| β-strand | 1544-1546 | 3 | 1 |
| β-strand | 1553-1555 | 3 | 2 |
| β-strand | 1562-1564 | 3 | 1 |
| β-strand | 1571-1573 | 3 | 2 |
| β-strand | 1580-1584 | 5 | 1 |
| β-strand | 1589-1593 | 5 | 2 |
| β-strand | 1598-1603 | 6 | 1 |
| β-strand | 1610-1614 | 5 | 2 |
| α-helix | 1617-1619 | 3 | |
| β-strand | 1620-1625 | 6 | 1 |
| β-strand | 1628-1633 | 6 | 1 |
| β-strand | 1639-1642 | 4 | 1 |
| α-helix | 1649-1651 | 3 | |
| β-strand | 1655-1658 | 4 | 2 |
| β-strand | 1661-1664 | 4 | 2 |
| α-helix | 1665-1674 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bifunctional hemolysin/adenylate cyclase | A | protein | 320 | Bordetella pertussis Tohama I | P0DKX7 (AlphaFold model) |
>6SUS_1 Bifunctional hemolysin/adenylate cyclase (chains A) GILADLGAGRVDKLGEAGSSAYDTVSGIENVVGTELADRITGDAQANVLRGAGGADVLAG GEGDDVLLGGDGDDQLSGDAGRDRLYGEAGDDWFFQDAANAGNLLDGGDGRDTVDFSGPG RGLDAGAKGVFLSLGKGFASLMDEPETSNVLRNIENAVGSARDDVLIGDAGANVLNGLAG NDVLSGGAGDDVLLGDEGSDLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDT IRINAGADQLWFARQGNDLEIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEK LVEAMAQYPDPGAAAAAPPA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 15 |
Water and common crystallization additives (EDO, NO3, GOL, PGE) are not listed.
Continuous Assembly of beta-Roll Structures Is Implicated in the Type I-Dependent Secretion of Large Repeat-in-Toxins (RTX) Proteins. Motlova, L., Klimova, N., Fiser, R. et al. J Mol Biol (2020) 432:5696-5710. DOI 10.1016/j.jmb.2020.08.020 · PubMed
Other PDB entries of the same protein (UniProt P0DKX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6SUS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.