Crystal structure of Sr2+-bound RTX domain block V of adenylate cyclase toxin from Bordetella pertussis. Determined by X-ray diffraction at 1.5 Å resolution. Released 7 Jan 2026.
Explore 9P0D in 3D Show helices and sheets RCSB PDB PDBe
9P0D contains 3 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1526-1528 | 3 | 1 |
| β-strand | 1535-1537 | 3 | 2 |
| β-strand | 1544-1546 | 3 | 1 |
| β-strand | 1553-1555 | 3 | 2 |
| β-strand | 1562-1564 | 3 | 1 |
| β-strand | 1571-1573 | 3 | 2 |
| β-strand | 1580-1584 | 5 | 1 |
| β-strand | 1589-1593 | 5 | 2 |
| β-strand | 1598-1603 | 6 | 1 |
| β-strand | 1610-1614 | 5 | 2 |
| α-helix | 1617-1619 | 3 | |
| β-strand | 1620-1625 | 6 | 1 |
| β-strand | 1628-1633 | 6 | 1 |
| β-strand | 1639-1642 | 4 | 1 |
| α-helix | 1649-1651 | 3 | |
| β-strand | 1655-1657 | 3 | 2 |
| β-strand | 1662-1664 | 3 | 2 |
| α-helix | 1665-1675 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemolysin | A | protein | 179 | Bordetella pertussis | P0DKX7 (AlphaFold model) |
>9P0D_1 Hemolysin (chains A) MRGSHHHHHHGSHMELGASGSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGS DLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDL EIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQYPDEFTSLEKN
Water and common crystallization additives (CL, TRS, GOL, NA) are not listed.
Ion-selective conformational stabilization of a disordered repeats-in-toxin protein domain. Gudinas, A.P., Shambharkar, G.M., Chang, M.P. et al. Biophys J (2025) 124:4243-4254. DOI 10.1016/j.bpj.2025.10.014 · PubMed
Other PDB entries of the same protein (UniProt P0DKX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9P0D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.