Crystal structure of Ca2+-bound RTX domain block V of adenylate cyclase toxin from Bordetella pertussis. Determined by X-ray diffraction at 1.7 Å resolution. Released 7 Jan 2026.
Explore 9P0C in 3D Show helices and sheets RCSB PDB PDBe
9P0C contains 7 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1514-1519 | 6 | 1 |
| β-strand | 1522-1528 | 7 | 1 |
| β-strand | 1535-1537 | 3 | 2 |
| β-strand | 1542-1546 | 5 | 1 |
| β-strand | 1553-1555 | 3 | 2 |
| β-strand | 1561-1564 | 4 | 1 |
| β-strand | 1571-1573 | 3 | 2 |
| β-strand | 1580-1584 | 5 | 1 |
| β-strand | 1589-1592 | 4 | 2 |
| β-strand | 1598-1603 | 6 | 1 |
| β-strand | 1610-1613 | 4 | 2 |
| α-helix | 1617-1619 | 3 | |
| β-strand | 1620-1625 | 6 | 1 |
| β-strand | 1628-1633 | 6 | 1 |
| β-strand | 1639-1642 | 4 | 1 |
| α-helix | 1649-1651 | 3 | |
| β-strand | 1655-1658 | 4 | 2 |
| β-strand | 1661-1664 | 4 | 2 |
| α-helix | 1665-1677 | 13 | |
| α-helix | 1679-1681 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1517-1519 | 3 | 3 |
| β-strand | 1522-1528 | 7 | 3 |
| β-strand | 1535-1537 | 3 | 4 |
| β-strand | 1542-1546 | 5 | 3 |
| β-strand | 1553-1555 | 3 | 4 |
| β-strand | 1562-1564 | 3 | 3 |
| β-strand | 1571-1573 | 3 | 4 |
| β-strand | 1580-1584 | 5 | 3 |
| β-strand | 1589-1592 | 4 | 4 |
| β-strand | 1598-1603 | 6 | 3 |
| β-strand | 1610-1613 | 4 | 4 |
| α-helix | 1617-1619 | 3 | |
| β-strand | 1620-1625 | 6 | 3 |
| β-strand | 1628-1633 | 6 | 3 |
| β-strand | 1639-1642 | 4 | 3 |
| α-helix | 1649-1651 | 3 | |
| β-strand | 1655-1658 | 4 | 4 |
| β-strand | 1662-1663 | 2 | 4 |
| α-helix | 1665-1677 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemolysin | A, B | protein | 179 | Bordetella pertussis | P0DKX7 (AlphaFold model) |
>9P0C_1 Hemolysin (chains A, B) MRGSHHHHHHGSHMELGASGSARDDVLIGDAGANVLNGLAGNDVLSGGAGDDVLLGDEGS DLLSGDAGNDDLFGGQGDDTYLFGVGYGHDTIYESGGGHDTIRINAGADQLWFARQGNDL EIRILGTDDALTVHDWYRDADHRVEIIHAANQAVDQAGIEKLVEAMAQYPDEFTSLEKN
Water and common crystallization additives (CL, GOL) are not listed.
Ion-selective conformational stabilization of a disordered repeats-in-toxin protein domain. Gudinas, A.P., Shambharkar, G.M., Chang, M.P. et al. Biophys J (2025) 124:4243-4254. DOI 10.1016/j.bpj.2025.10.014 · PubMed
Other PDB entries of the same protein (UniProt P0DKX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9P0C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.