Streptavidin variants harbouring an artificial organocatalyst based cofactor. Determined by X-ray diffraction at 1.0 Å resolution. Released 14 Oct 2020.
Explore 6T2L in 3D Show helices and sheets RCSB PDB PDBe
6T2L contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-22 | 4 | 1 |
| β-strand | 28-33 | 6 | 1 |
| β-strand | 38-44 | 7 | 1 |
| β-strand | 54-60 | 7 | 1 |
| β-strand | 71-80 | 10 | 1 |
| β-strand | 85-97 | 13 | 1 |
| β-strand | 103-112 | 10 | 1 |
| α-helix | 116-121 | 6 | |
| β-strand | 123-131 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Streptavidin | A | protein | 159 | Streptomyces avidinii | P22629 (AlphaFold model) |
>6T2L_1 Streptavidin (chains A) MASMTGGQQMGRDEAGITGTWYNQLGSTFIVTAGADGALTGTYESAAGKAESRYVLTGRY DSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTAGATEANGW ASTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| HL9 | 5-[(3~{a}~{S},4~{S},6~{a}~{R})-2-oxidanylidene-1,3,3~{a},4,6,6~{a}-hexahydrothi… | C20 H29 N5 O2 S | 1 |
Water and common crystallization additives (GOL, EDO) are not listed.
An Artificial Cofactor Catalyzing the Baylis-Hillman Reaction with Designed Streptavidin as Protein Host*. Lechner, H., Emann, V.R., Breuning, M. et al. Chembiochem (2021) 22:1573-1577. DOI 10.1002/cbic.202000880 · PubMed
Other PDB entries of the same protein (UniProt P22629 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6T2L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.