IRF4 DNA-binding domain surface entropy mutant apo structure. Determined by X-ray diffraction at 1.71 Å resolution. Released 18 Nov 2020.
Explore 6TD4 in 3D Show helices and sheets RCSB PDB PDBe
6TD4 contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-34 | 12 | |
| β-strand | 41-44 | 4 | 1 |
| β-strand | 49-53 | 5 | 1 |
| α-helix | 69-77 | 9 | |
| α-helix | 87-88 | 2 | |
| α-helix | 90-103 | 14 | |
| β-strand | 107-109 | 3 | 1 |
| α-helix | 111-113 | 3 | |
| β-strand | 115 | 1 | 1 |
| β-strand | 122-127 | 6 | 1 |
| α-helix | 128-129 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interferon regulatory factor 4 | A | protein | 121 | Homo sapiens | Q15306 (AlphaFold model) |
>6TD4_1 Interferon regulatory factor 4 (chains A) GPMGHMGNGKLRQWLIDQIDSGKYPGLVWENAAASIFRIPWKHAGKQDYNREEDAALFKA WALFKGKFREGIDKPDPPTWKTRLRSALNKSNDFEELVERSQLDISDPYKVYRIVPEGAL E
Cancer-associated mutations in the IRF4 DNA-binding domain confer no disadvantage in DNA-binding affinity and may increase transcriptional activity. Tatum, N.J., Scott, R., Doody, G.M. et al. To be published.
Other PDB entries of the same protein (UniProt Q15306 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TD4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.