6TGK: Domain swapped E6AP C-lobe dimer

Name: PDB 6TGK: Domain swapped E6AP C-lobe dimer
Published: 2020-02-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Domain swapped E6AP C-lobe dimer. Determined by X-ray diffraction at 1.3 Å resolution. Released 26 Feb 2020.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,051
Mol. weight: 12.22 kDa
Ligands: CA
Released: 26 Feb 2020

Explore 6TGK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6TGK contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	744-750	7
β-strand	752-754	3	1
α-helix	762-772	11
α-helix	776-787	12
α-helix	792-793	2
α-helix	797-799	3
β-strand	803-805	3	1
α-helix	814-815	2
α-helix	832-844	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-protein ligase E3A	C	protein	105	Homo sapiens	Q05086 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>6TGK_1 Ubiquitin-protein ligase E3A (chains C)
LDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLK
MIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYA

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Crystal structure of the catalytic C-lobe of the HECT-type ubiquitin ligase E6AP. Ries, L.K., Liess, A.K.L., Feiler, C.G. et al. Protein Sci (2020) 29:1550-1554. DOI 10.1002/pro.3832 · PubMed

Other PDB entries of the same protein (UniProt Q05086 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJV 2.03 Å, Structure of HPV18 E6 oncoprotein in complex with mutant E6AP LxxLL motif
4XR8 2.25 Å, Crystal structure of the HPV16 E6/E6AP/p53 ternary complex at 2.25 A resolution
7QPB 2.34 Å, Catalytic C-lobe of the HECT-type ubiquitin ligase E6AP in complex with a hybrid…
4GIZ 2.55 Å, Crystal structure of full-length human papillomavirus oncoprotein E6 in complex with…
9L3L 2.59 Å, Crystal structure of the C lobe of E6AP in complex with K48-linked diUb
1C4Z 2.6 Å, Structure of an E6AP-UBCH7 complex: insights into the ubiquitination pathway
8JRN 2.6 Å, Structure of E6AP-E6 complex in Att1 state
1D5F 2.8 Å, Structure of E6AP: insights into ubiquitination pathway
6SLM 2.8 Å, Crystal structure of full-length HPV31 E6 oncoprotein in complex with LXXLL peptide of…
8JRO 3.01 Å, Structure of E6AP-E6 complex in Att2 state
7Q41 3.01 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…
9U4A 3.3 Å, Structure of UBE3A T485E tetramer

Browse structure collections

About this viewer

MolViewer shows 6TGK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.