6UA3: Human Mcl-1

Human Mcl-1 in complex with a modified Bim BH3 peptide. Determined by X-ray diffraction at 1.55 Å resolution. Released 16 Sept 2020.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,578
Mol. weight: 20.44 kDa
Released: 16 Sept 2020

Explore 6UA3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UA3 contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	173-191	19
α-helix	198-200	3
α-helix	203-223	21
α-helix	225-235	11
α-helix	240-251	12
α-helix	252-254	3
α-helix	261-280	20
α-helix	284-286	3
α-helix	287-295	9
α-helix	296-300	5
α-helix	301-308	8
α-helix	311-318	8

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-22	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Induced myeloid leukemia cell differentiation protein Mcl-1	A	protein	156	Homo sapiens	Q07820 (AlphaFold model)
modified Bim BH3 peptide	B	protein	23	Homo sapiens	O43521 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6UA3_1 Induced myeloid leukemia cell differentiation protein Mcl-1 (chains A)
GSDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQ
GMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEP
LAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLE

Sequence of entity 2 (B), FASTA

>6UA3_2 modified Bim BH3 peptide (chains B)
XIWLAQGARRLGDEINAYYARRX

Primary citation

Inhibitor peptides against Mcl-1 containing non-natural amino acids show potent apoptotic response. Mandal, T., Grant, R.A., Keating, A.E. To be published.

Other PDB entries of the same protein (UniProt Q07820 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJP 1.13 Å, Histidine-covalent stapled alpha-helical peptide (155H1) targeting hMcl-1
9PQ7 1.24 Å, MBP-Mcl1 in complex with ligand 21b
9PQ5 1.28 Å, MBP-Mcl1 in complex with ligand 8
6UDV 1.35 Å, X-ray co-crystal structure of compound 3 bound to human Mcl-1
9UGP 1.39 Å, Crystal structure of MCL-1 in complex with HRK BH3
8G3S 1.4 Å, MBP-Mcl1 in complex with ligand 11
5W89 1.42 Å, Crystal structure of human Mcl-1 in complex with modified Bim BH3 peptide SAH-MS1-18
5C3F 1.43 Å, Crystal structure of Mcl-1 bound to BID-MM
8G3X 1.46 Å, MBP-Mcl1 in complex with ligand 32
8H7B 1.46 Å, The crystal structure of human mcl1 kinase domain in complex with MCL1-M-EBA
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
6OQD 1.48 Å, Crystal structure of Mcl1 with inhibitor 8

Browse structure collections

About this viewer

MolViewer shows 6UA3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.