6ULS: BRD4-BD1

Name: PDB 6ULS: BRD4-BD1 in complex with the a diacetylated-E2F1 peptide
Published: 2020-08-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

BRD4-BD1 in complex with the a diacetylated-E2F1 peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 19 Aug 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,274
Mol. weight: 18.25 kDa
Released: 19 Aug 2020

Explore 6ULS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ULS contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	44-49	6
α-helix	56-57	2
α-helix	61-65	5
α-helix	66-71	6
α-helix	72-75	4
α-helix	81-83	3
α-helix	89-92	4
α-helix	97-100	4
α-helix	107-115	9
α-helix	122-139	18
α-helix	141	1
α-helix	145-161	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 4	A	protein	146	Homo sapiens	O60885 (AlphaFold model)
Diacetylated E2F1 Peptide (K117ac and K120ac)	B	protein	11	Homo sapiens	Q01094 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ULS_1 Bromodomain-containing protein 4 (chains A)
QGPLGSSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLP
DYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEK
LFLQKINELPTEEPEFPGRLERPHRD

Sequence of entity 2 (B), FASTA

>6ULS_2 Diacetylated E2F1 Peptide (K117ac and K120ac) (chains B)
HPGKGVKSPGX

Primary citation

BET-Family Bromodomains Can Recognize Diacetylated Sequences from Transcription Factors Using a Conserved Mechanism. Patel, K., Solomon, P.D., Walshe, J.L. et al. Biochemistry (2021) 60:648-662. DOI 10.1021/acs.biochem.0c00816 · PubMed

Other PDB entries of the same protein (UniProt O60885 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QB3 0.94 Å, Crystal structure of the first bromodomain of human BRD4 in complex with Olinone
6FO5 0.95 Å, First domain of human bromodomain BRD4 in complex with inhibitor #17
7Z9W 0.99 Å, BRD4 in complex with FragLite1
4ZC9 0.99 Å, Crystal Structure of the BRD4a/DB-2-190 complex
9P34 0.99 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
6I7Y 1.0 Å, Crystal Structure of the first bromodomain of BRD4 in complex with RT56
7ZAJ 1.0 Å, BRD4 in complex with FragLite16
8YMG 1.01 Å, BRD4-BD1 in complex with 7-[4-chloro-1-(tetrahydropyran-4-ylmethyl)imidazol-2-yl]-5-methy…
8YMI 1.01 Å, BRD4-BD1 in complex with 2-{[(3S)-1-benzylpyrrolidin-3-yl]methyl}-5-methyl-7-(1-methylpyr…
9P33 1.01 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
8YMF 1.01 Å, BRD4-BD1 in complex with 7-[2-(cyclopropylmethoxy)phenyl]-5-methyl-2-[(1-methylsulfonyl-4…
7Z9Y 1.04 Å, BRD4 in complex with FragLite2

Browse structure collections

About this viewer

MolViewer shows 6ULS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.