6UO8: Human metabotropic GABA(B) receptor

Human metabotropic GABA(B) receptor bound to agonist SKF97541 and positive allosteric modulator GS39783. Determined by electron microscopy at 3.63 Å resolution. Released 10 Jun 2020.

Method: Electron microscopy
Resolution: 3.63 Å
Organism: Homo sapiens
Chains: 2
Atoms: 10,958
Mol. weight: 177.89 kDa
Ligands: QD7, NAG, QDA
Released: 10 Jun 2020

Explore 6UO8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UO8 contains 54 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	168-176	9	1
α-helix	185-199	15
β-strand	209-217	9	1
α-helix	222-233	12
α-helix	238	1
β-strand	239-243	5	1
α-helix	247-256	10
α-helix	257-259	3
β-strand	263-266	4	1
α-helix	272-275	4
β-strand	283-285	3	1
α-helix	288-289	2
α-helix	290-292	3
α-helix	294-303	10
β-strand	308-314	7	2
α-helix	317-329	13
α-helix	331-333	3
β-strand	336-339	4	2
β-strand	342-343	2	2
α-helix	348-357	10
β-strand	361-365	5	2
α-helix	369-378	10
α-helix	379-381	3
β-strand	389-393	5	2
α-helix	413-416	4
β-strand	422-427	6	2
α-helix	445-453	9
α-helix	467-484	18
α-helix	506-514	9
β-strand	519	1	3
β-strand	524	1	3
β-strand	537-543	7	2
β-strand	546-553	8	2
α-helix	569-571	3
β-strand	580-583	4	4
α-helix	590-615	26
α-helix	620-623	4
α-helix	628-641	14
α-helix	645-648	4
α-helix	659-690	32
α-helix	708-730	23
β-strand	737-740	4	4
β-strand	754-760	7	4
α-helix	769-789	21
α-helix	801-823	23
α-helix	833-853	21
α-helix	855-861	7

Chain B: 25 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	55-61	7	5
α-helix	72-89	18
β-strand	98-104	7	5
α-helix	110-122	13
β-strand	127-132	6	5
α-helix	138-143	6
β-strand	153-155	3	5
α-helix	161-164	4
β-strand	172-174	3	5
α-helix	183-190	8
β-strand	198-202	5	6
α-helix	207-218	12
β-strand	226-231	6	6
α-helix	236-238	3
α-helix	240-245	6
β-strand	250-254	5	6
α-helix	257-269	13
β-strand	278-282	5	6
α-helix	285-286	2
α-helix	305-308	4
β-strand	315-319	5	6
α-helix	335-345	11
α-helix	349-351	3
α-helix	359-373	15
α-helix	379-383	5
α-helix	393-404	12
β-strand	409	1	7
β-strand	414	1	7
β-strand	416-418	3	8
β-strand	421-423	3	8
β-strand	425-431	7	6
β-strand	436-443	8	6
β-strand	449-451	3	6
α-helix	468-469	2
β-strand	470-474	5	9
α-helix	475-478	4
α-helix	479-505	27
α-helix	517-537	21
α-helix	549-581	33
α-helix	596-613	18
β-strand	626-627	2	9
β-strand	640-645	6	9
α-helix	658-679	22
α-helix	691-710	20
α-helix	720-749	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid type B receptor subunit 1	A	protein	762	Homo sapiens	Q9UBS5 (AlphaFold model)
Gamma-aminobutyric acid type B receptor subunit 2	B	protein	779	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6UO8_1 Gamma-aminobutyric acid type B receptor subunit 1 (chains A)
GSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPG
QATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTF
FRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSF
FSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKI
YDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGG
FQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSG
HVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKT
FRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAA
VFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRK
TLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSS
RKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVT
MILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNN
EEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRLEVLFQ

Sequence of entity 2 (B), FASTA

>6UO8_2 Gamma-aminobutyric acid type B receptor subunit 2 (chains B)
GWARGAPRPPPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLD
LRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATT
PVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLY
GEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWI
IPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYER
EYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIIL
NAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQG
SEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMN
NLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHA
IFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDIS
IRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVG
IMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRF
QFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDT

Ligands and cofactors

ID	Name	Formula	Copies
QD7	(R)-(3-aminopropyl)methylphosphinic acid	C4 H12 N O2 P	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	6
QDA	N~4~,N~6~-dicyclopentyl-2-(methylsulfanyl)-5-nitropyrimidine-4,6-diamine	C15 H23 N5 O2 S	1

Primary citation

Structural basis of the activation of a metabotropic GABA receptor. Shaye, H., Ishchenko, A., Lam, J.H. et al. Nature (2020) 584:298-303. DOI 10.1038/s41586-020-2408-4 · PubMed

Other PDB entries of the same protein (UniProt Q9UBS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PAS 1.62 Å, Heterodimeric coiled-coil structure of human GABA(B) receptor
4MS4 1.9 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR7 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR8 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQF 2.22 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS1 2.25 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQE 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor in the apo form
4MR9 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS3 2.5 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MRM 2.86 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
7C7S 2.9 Å, Cryo-EM structure of the CGP54626-bound human GABA(B) receptor in inactive state.
7C7Q 3.0 Å, Cryo-EM structure of the baclofen/BHFF-bound human GABA(B) receptor in active state

Browse structure collections

About this viewer

MolViewer shows 6UO8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.