6UP7: Neurotensin receptor and arrestin2 complex

neurotensin receptor and arrestin2 complex. Determined by electron microscopy at 4.2 Å resolution. Released 26 Feb 2020.

Method: Electron microscopy
Resolution: 4.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,166
Mol. weight: 78.77 kDa
Ligands: PIO
Released: 26 Feb 2020

Explore 6UP7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UP7 contains 21 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
β-strand	19-20	2	1
β-strand	26-27	2	2
β-strand	36-37	2	3
β-strand	41-42	2	1
β-strand	52-60	9	4
α-helix	68-70	3
β-strand	83-85	3	4
α-helix	99-106	8
β-strand	112-113	2	1
β-strand	117-118	2	3
β-strand	143-151	9	4
β-strand	169-170	2	2
β-strand	183-185	3	5
β-strand	198-202	5	5
α-helix	212-213	2
β-strand	214-215	2	6
β-strand	217-221	5	5
α-helix	229	1
β-strand	230-241	12	7
β-strand	249-252	4	7
β-strand	256-257	2	7
β-strand	267-268	2	5
β-strand	273-274	2	6
β-strand	289	1	8
α-helix	298-299	2
β-strand	300	1	8
α-helix	301-305	5
β-strand	317-328	12	7
β-strand	343-349	7	7

Chain R: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	52-54	3
α-helix	60-92	33
α-helix	102-122	21
α-helix	123-129	7
α-helix	138-171	34
α-helix	175-179	5
α-helix	182-199	18
α-helix	201-204	4
β-strand	210-211	2	9
β-strand	222-223	2	9
α-helix	230-241	12
α-helix	242-246	5
α-helix	247-269	23
α-helix	296-327	32
α-helix	336-361	26
α-helix	362-366	5
α-helix	370-382	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Arg-arg-pro-tyr-ile-leu	C	protein	6	Homo sapiens	P30990 (AlphaFold model)
Beta-arrestin-1	B	protein	348	Homo sapiens	P49407 (AlphaFold model)
Neurotensin receptor type 1	R	protein	334	Homo sapiens	P30989 (AlphaFold model)
unidentified peptide	V	protein	9	Homo sapiens

Sequence of entity 1 (C), FASTA

>6UP7_1 ARG-ARG-PRO-TYR-ILE-LEU (chains C)
RRPYIL

Sequence of entity 2 (B), FASTA

>6UP7_2 Beta-arrestin-1 (chains B)
VFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTVAFRYGRED
LDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPSSV
TLQPGPEDTGKALGVDYEVKAFVAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETT
RQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADIVLFNTA
QYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLR
EGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPK

Sequence of entity 3 (R), FASTA

>6UP7_3 Neurotensin receptor type 1 (chains R)
PSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVTAFTLARKKSLQSLQSTVHYHLGSLA
LSDLLTLLLAMPVELYNFIWVHHPWAFGDAGCRGYYFLRDACTYATALNVASLSVERYLA
ICHPFKAKTLMSRSRTKKFISAIWLASALLAVPMLFTMGEQNRSADGQHAGGLVCTPTIH
TATVKVVIQVNTFMSFIFPMVVISVLNTIIANKLTVMVRQAAEQGQVCTVGGEHSTFSMA
IEPGRVQALRHGVRVLRAVVIAFVVCWLPYHVRRLMFCYISDEQWTPFLYDFYHYFYMVT
NALFYVSSTINPILYNLVSANFRHIFLATLACLC

Sequence of entity 4 (V), FASTA

>6UP7_4 unidentified peptide (chains V)
XXXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	1

Primary citation

Structure of the neurotensin receptor 1 in complex with beta-arrestin 1. Huang, W., Masureel, M., Qu, Q. et al. Nature (2020) 579:303-308. DOI 10.1038/s41586-020-1953-1 · PubMed

Other PDB entries of the same protein (UniProt P30990 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJY 1.95 Å, Structure of Human Neurolysin in complex with Neurotensin peptide
3F6K 2.0 Å, Crystal structure of the Vps10p domain of human sortilin/NTS3 in complex with neurotensin
4PO7 2.66 Å, Structure of the Sortilin:neurotensin complex at excess neurotensin concentration
5LUZ 2.7 Å, Structure of Human Neurolysin (E475Q) in complex with neurotensin peptide products
2LNE Neurotensin 40 structures in water pH 5.5 298 K. NMR data & structures
2LNF Neurotensin 40 structures in DMPC/CHAPS(q=0.25) bicelle pH 5.5 & 298K. NMR data &…
2LNG Neurotensin 40 structures in DMPC:CHAPS:GM1(q= 0.25) bicelle pH 5.5 & 298K. NMR data &…
2LYW Intermolecular interactions between neurotensin and the third extracellular loop of…
2OYV Neurotensin in DPC micelles
2OYW Neurotensin in TFE:H2O (80:20)

Browse structure collections

About this viewer

MolViewer shows 6UP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.