6UQC: Mouse IgG2a Bispecific Fc

Mouse IgG2a Bispecific Fc. Determined by X-ray diffraction at 1.87 Å resolution. Released 1 Jan 2020.

Method: X-ray diffraction
Resolution: 1.87 Å
Organism: Mus musculus
Chains: 4
Atoms: 8,155
Mol. weight: 100.89 kDa
Ligands: FUC, NAG
Released: 1 Jan 2020

Explore 6UQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UQC contains 43 α-helices and 80 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	1
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	1
β-strand	267	1	2
β-strand	270	1	2
β-strand	274-279	6	3
β-strand	282-284	3	3
β-strand	288-294	7	1
β-strand	299-307	9	1
α-helix	310-314	5
β-strand	319-324	6	3
β-strand	332-336	5	3
α-helix	338-340	3
β-strand	344	1	4
α-helix	345-346	2
β-strand	347-351	5	5
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	5
β-strand	373	1	4
β-strand	378-383	6	6
β-strand	386-387	2	6
α-helix	388	1
β-strand	391-393	3	5
α-helix	394-396	3
β-strand	397-398	2	5
β-strand	404-413	10	5
α-helix	414-418	5
β-strand	424-428	5	6
α-helix	433-435	3
β-strand	436-440	5	6

Chain D: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	7
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	7
β-strand	267	1	8
β-strand	270	1	8
β-strand	274-279	6	9
β-strand	282-284	3	9
β-strand	288-294	7	7
β-strand	299-307	9	7
α-helix	310-314	5
β-strand	319-324	6	9
β-strand	332-336	5	9
α-helix	338-340	3
β-strand	344	1	10
α-helix	345-346	2
β-strand	347-351	5	11
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	11
β-strand	373	1	10
β-strand	378-383	6	12
β-strand	386-387	2	12
α-helix	388	1
β-strand	391-393	3	11
α-helix	394-396	3
β-strand	397-398	2	11
β-strand	404-413	10	11
α-helix	414-418	5
β-strand	423-428	6	12
α-helix	433-435	3
β-strand	436-440	5	12

Chain E: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	13
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	13
β-strand	274-279	6	14
β-strand	282-284	3	14
β-strand	288-294	7	13
β-strand	299-307	9	13
α-helix	310-314	5
β-strand	319-324	6	14
β-strand	332-336	5	14
α-helix	338-340	3
β-strand	344	1	15
α-helix	345-346	2
β-strand	347-351	5	16
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	16
β-strand	373	1	15
β-strand	378-383	6	17
β-strand	386-387	2	17
α-helix	388	1
β-strand	391-393	3	16
α-helix	394-396	3
β-strand	397-398	2	16
β-strand	404-413	10	16
α-helix	414-418	5
β-strand	424-428	5	17
α-helix	433-435	3
β-strand	436-440	5	17

Chain F: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	18
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	18
β-strand	274-279	6	19
β-strand	282-284	3	19
β-strand	288-294	7	18
β-strand	299-307	9	18
α-helix	310-314	5
β-strand	319-324	6	19
β-strand	332-336	5	19
α-helix	338-340	3
β-strand	344	1	20
α-helix	345-346	2
β-strand	347-351	5	21
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	21
β-strand	373	1	20
β-strand	378-383	6	22
β-strand	386-387	2	22
β-strand	391-393	3	21
α-helix	394-396	3
β-strand	397-398	2	21
β-strand	404-413	10	21
α-helix	414-418	5
β-strand	424-428	5	22
α-helix	433-435	3
β-strand	436-440	5	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig gamma-2A chain C region, membrane-bound form	C, D	protein	207	Mus musculus	P01865 (AlphaFold model)
Ig gamma-2A chain C region, membrane-bound form	E, F	protein	207	Mus musculus	P01865 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>6UQC_1 Ig gamma-2A chain C region, membrane-bound form (chains C, D)
GPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDY
NSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEK
EMTKKQVSLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSDLTVEKKN
WVERNSYSCSVVHEGLHNHHTTKSFSR

Sequence of entity 2 (E, F), FASTA

>6UQC_2 Ig gamma-2A chain C region, membrane-bound form (chains E, F)
GPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDY
NSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEE
EMTKKQVTLTCLVKDFMPEDIYVEWTNNGKTELNYKNTEPVLKSDGSYFMYSKLRVEKKN
WVERNSYSCSVVHEGLHNHHTTESFSR

Ligands and cofactors

ID	Name	Formula	Copies
FUC	alpha-L-fucopyranose	C6 H12 O5	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Design and characterization of mouse IgG1 and IgG2a bispecific antibodies for use in syngeneic models. Wang, F., Tsai, J.C., Davis, J.H. et al. MAbs (2019) 12:1685350-1685350. DOI 10.1080/19420862.2019.1685350 · PubMed

Other PDB entries of the same protein (UniProt P01865 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NCW 1.3 Å, Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid
1RUK 1.4 Å, Crystal structure (C) of native cationic cyclization antibody 4C6 fab at pH 4.6 with a…
1RUP 1.4 Å, Crystal structure (G) of native cationic cyclization antibody 4C6 fab at pH 8.5 with a…
1RUM 1.48 Å, Crystal structure (F) of H2O2-soaked cationic cyclization antibody 4C6 fab at pH 8.5…
1RUA 1.75 Å, Crystal structure (B) of u.v.-irradiated cationic cyclization antibody 4C6 fab at pH 4.6…
1NBY 1.8 Å, Crystal Structure of HyHEL-63 complexed with HEL mutant K96A
1FLR 1.85 Å, 4-4-20 FAB fragment
1RUL 1.88 Å, Crystal Structure (D) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 5.6…
1NDG 1.9 Å, Crystal structure of Fab fragment of antibody HyHEL-8 complexed with its antigen lysozyme
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3FO9 1.9 Å, Crystal structure of aldolase antibody 33F12 Fab' in complex with hapten 1,3-diketone
1E4W 1.95 Å, crossreactive binding of a circularized peptide to an anti-TGFalpha antibody Fab-fragment

Browse structure collections

About this viewer

MolViewer shows 6UQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.