Coagulation factor XI catalytic domain (C123S) in complex with nvp-XIV936. Determined by X-ray diffraction at 1.26 Å resolution. Released 1 Jul 2020.
Explore 6USY in 3D Show helices and sheets RCSB PDB PDBe
6USY contains 11 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| β-strand | 30-35 | 6 | 3 |
| β-strand | 37D-46 | 10 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-59 | 4 | |
| α-helix | 62-64 | 3 | |
| β-strand | 65-68 | 4 | 3 |
| β-strand | 73 | 1 | 4 |
| α-helix | 74-76 | 3 | |
| β-strand | 83-90 | 8 | 3 |
| α-helix | 97-99 | 3 | |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 111-114 | 4 | |
| β-strand | 115 | 1 | 5 |
| β-strand | 118 | 1 | 5 |
| β-strand | 123 | 1 | 2 |
| α-helix | 124 | 1 | |
| α-helix | 126 | 1 | |
| β-strand | 136-140 | 5 | 2 |
| β-strand | 154 | 1 | 4 |
| α-helix | 155 | 1 | |
| β-strand | 156-159 | 4 | 2 |
| β-strand | 162-163 | 2 | 2 |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-202A | 6 | 2 |
| β-strand | 202D-215 | 10 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-242 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor XIa light chain | A | protein | 238 | Homo sapiens | P03951 (AlphaFold model) |
>6USY_1 Coagulation factor XIa light chain (chains A) IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG ILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPISLPSKGDR NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGG KDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| QGS | 1-[(2S)-2-{3-[(3S)-3-amino-2,3-dihydro-1-benzofuran-5-yl]-5-(propan-2-yl)phenyl… | C28 H28 N2 O4 | 1 |
Structure-Based Design and Preclinical Characterization of Selective and Orally Bioavailable Factor XIa Inhibitors: Demonstrating the Power of an Integrated S1 Protease Family Approach. Lorthiois, E., Roache, J., Barnes-Seeman, D. et al. J Med Chem (2020) 63:8088-8113. DOI 10.1021/acs.jmedchem.0c00279 · PubMed
Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6USY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.