6UUQ: Calcineurin

Structure of Calcineurin bound to RCAN1. Determined by X-ray diffraction at 1.85 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,936
Mol. weight: 41.12 kDa
Ligands: FE, ZN, PO4
Released: 9 Sept 2020

Explore 6UUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UUQ contains 19 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	27-28	2
β-strand	29	1	1
α-helix	30	1
α-helix	31-34	4
β-strand	35	1	2
β-strand	41	1	2
α-helix	43-50	8
α-helix	54-55	2
β-strand	56	1	1
α-helix	57	1
α-helix	58-73	16
β-strand	78-81	4	3
α-helix	82	1
β-strand	85-88	4	4
α-helix	95-105	11
β-strand	113-115	3	4
α-helix	126-139	14
β-strand	144-146	3	4
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-183	12
β-strand	188-191	4	3
β-strand	195-197	3	3
α-helix	209-213	5
α-helix	220-222	3
α-helix	226-232	7
β-strand	234-235	2	5
β-strand	248-250	3	5
β-strand	258-260	3	5
α-helix	262-271	10
β-strand	276-279	4	3
β-strand	288-290	3	3
α-helix	292	1
β-strand	293	1	6
α-helix	294	1
β-strand	300	1	6
β-strand	302-305	4	3
β-strand	310-311	2	7
β-strand	315-316	2	7
β-strand	319-325	7	4
β-strand	328-334	7	4

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	155-159	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	A	protein	316	Homo sapiens	Q08209 (AlphaFold model)
Calcipressin-1	B	protein	40	Homo sapiens	P53805 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6UUQ_1 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (chains A)
MGSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDA
PVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKT
LFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLS
PEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYP
AVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLK
YENNVMNIRQFNCSPH

Sequence of entity 2 (B), FASTA

>6UUQ_2 Calcipressin-1 (chains B)
GHMNYDLLYAISKLGPGEKYELHAATDTTPSVVITVCESD

Ligands and cofactors

ID	Name	Formula	Copies
FE	FE (III) ion	Fe	1
ZN	Zinc ion	Zn	1
PO4	Phosphate ion	O4 P	2

Primary citation

The structure of the RCAN1:CN complex explains the inhibition of and substrate recruitment by calcineurin. Li, Y., Sheftic, S.R., Grigoriu, S. et al. Sci Adv (2020) 6. DOI 10.1126/sciadv.aba3681 · PubMed

Other PDB entries of the same protein (UniProt Q08209 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
4F0Z 1.7 Å, Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of…
2R28 1.86 Å, The complex Structure of Calmodulin Bound to a Calcineurin Peptide
6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
4Q5U 1.95 Å, Structure of calmodulin bound to its recognition site from calcineurin
3LL8 2.0 Å, Crystal Structure of Calcineurin in Complex with AKAP79 Peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
1AUI 2.1 Å, Human calcineurin heterodimer
9NXN 2.1 Å, Crystal structure of CN:RII alpha
2P6B 2.3 Å, Crystal Structure of Human Calcineurin in Complex with PVIVIT Peptide
6NUU 2.3 Å, Structure of Calcineurin mutant in complex with NHE1 peptide

Browse structure collections

About this viewer

MolViewer shows 6UUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.