6V6B: Gamma-tubulin complex component 3

Structures of GCP2 and GCP3 in the native human gamma-tubulin ring complex. Determined by electron microscopy at 3.8 Å resolution. Released 1 Jan 2020.

Method: Electron microscopy
Resolution: 3.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,115
Mol. weight: 209.48 kDa
Released: 1 Jan 2020

Explore 6V6B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V6B contains 64 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 32 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	247-257	11
β-strand	266	1	1
β-strand	277	1	1
α-helix	285-295	11
α-helix	298-310	13
α-helix	320-325	6
α-helix	330-344	15
α-helix	364-370	7
α-helix	377-387	11
α-helix	394-397	4
α-helix	415-433	19
β-strand	448-450	3	2
β-strand	464-466	3	2
α-helix	480-494	15
α-helix	529-551	23
α-helix	555-564	10
α-helix	572-580	9
α-helix	582-585	4
α-helix	589-591	3
α-helix	594-607	14
α-helix	609-611	3
α-helix	615-620	6
β-strand	623-625	3	3
α-helix	634-637	4
β-strand	638-640	3	3
α-helix	649-652	4
α-helix	656-675	20
α-helix	677-687	11
α-helix	698-722	25
α-helix	723-727	5
α-helix	728-730	3
α-helix	732-735	4
α-helix	745-761	17
α-helix	769-808	40
α-helix	826-838	13
α-helix	840-865	26
α-helix	874-880	7
α-helix	882-884	3

Chain C: 32 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	233-235	3
α-helix	238-252	15
β-strand	262-263	2	4
β-strand	274-275	2	4
α-helix	282-288	7
α-helix	292-294	3
α-helix	302-305	4
α-helix	311-313	3
α-helix	319-322	4
α-helix	326-334	9
α-helix	336-341	6
α-helix	349-355	7
α-helix	357-362	6
α-helix	366-372	7
α-helix	382-389	8
α-helix	401-408	8
α-helix	413-422	10
β-strand	437-438	2	5
β-strand	461-462	2	5
α-helix	472-474	3
α-helix	475-489	15
α-helix	513-532	20
α-helix	538-545	8
α-helix	553-562	10
α-helix	570	1
α-helix	576-589	14
α-helix	598-600	3
β-strand	601-604	4	6
β-strand	645-648	4	6
α-helix	653-656	4
α-helix	664-690	27
α-helix	708-718	11
α-helix	722-727	6
α-helix	731-740	10
α-helix	747-764	18
α-helix	775-790	16
α-helix	847-869	23
α-helix	882-887	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-tubulin complex component 3	B	protein	907	Homo sapiens	Q96CW5 (AlphaFold model)
Gamma-tubulin complex component 2	C	protein	930	Homo sapiens	Q9BSJ2 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>6V6B_1 Gamma-tubulin complex component 3 (chains B)
MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKK
ELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQ
ALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSL
LPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATTSKGVPSAVSRNMTRSRREGDTG
GTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGKANLSRSLRDTAVRLSELGWL
HNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLEDDQGVNLGLES
SLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILS
LVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQS
RKVLLIGKSINFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFE
TSKYLLDVLNKKYSLLDHMQAMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGI
LETAVRATNAQFDSPEILRRLDVRLLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHY
LRVFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQY
YITFEVLECSWDELWNKVQQAQDLDHIIAAHEVFLDTIISRCLLDSDSRALLNQLRAVFD
QIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESI
PKMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTR
GRRSSHT

Sequence of entity 2 (C), FASTA

>6V6B_2 Gamma-tubulin complex component 2 (chains C)
MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTP
EDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAAAAVGSSTTSI
NVPAAASKISMQELEELRKQLGSVATGSTLQQSLELKRKMLRDKQNKKNSGQHLPIFPAW
VYERPALIGDFLIGAGISTDTALPIVLLRWNLALSPRLKCSGVISAHCNLHLPGTLPLAS
QESAVVEDLLYVLVGVDGRYVSAQPLAGRQSRTFLVDPNLDLSIRELVHRILPVAASYSA
VTRFIEEKSSFEYGQVNHALAAAMRTLVKEHLILVSQLEQLHRQGLLSLQKLWFYIQPAM
RTMDILASLATSVDKGECLGGSTLSLLHDRSFSYTGDSQAQELCLYLTKAASAPYFEVLE
KWIYRGIIHDPYSEFMVEEHELRKERIQEDYNDKYWDQRYTIVQQQIPSFLQKMADKILS
TGKYLNVVRECGHDVTCPVAKEIIYTLKERAYVEQIEKAFNYASKVLLDFLMEEKELVAH
LRSIKRYFLMDQGDFFVHFMDLAEEELRKPVEDITPPRLEALLELALRMSTANTDPFKDD
LKIDLMPHDLITQLLRVLAIETKQEKAMAHADPTELALSGLEAFSFDYIVKWPLSLIINR
KALTRYQMLFRHMFYCKHVERQLCSVWISNKTAKQHSLHSAQWFAGAFTLRQRMLNFVQN
IQYYMMFEVMEPTWHILEKNLKSASNIDDVLGHHTGFLDTCLKDCMLTNPELLKVFSKLM
SVCVMFTNCMQKFTQSMKLDGELGGQTLEHSTVLGLPAGAEERARKELARKHLAEHADTV
QLVSGFEATINKFDKNFSAHLLDLLARLSIYSTSDCEHGMASVISRLDFNGFYTERLERL
SAERSQKATPQVPVLRGPPAPAPRVAVTAQ

Primary citation

Asymmetric Molecular Architecture of the Human gamma-Tubulin Ring Complex. Wieczorek, M., Urnavicius, L., Ti, S.C. et al. Cell (2020) 180:165-175.e16. DOI 10.1016/j.cell.2019.12.007 · PubMed

Other PDB entries of the same protein (UniProt Q96CW5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RX1 3.57 Å, CryoEM structure of the gTuRC-CM1dim complex
6X0U 3.6 Å, Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge
9SMX 3.67 Å, CM1-activated gTuRC in complex with nascent alpha-E254D mutant microtubules
8Q62 3.72 Å, Early closed conformation of the g-tubulin ring complex
7AS4 4.13 Å, Recombinant human gTuRC
6V6S 4.3 Å, Structure of the native human gamma-tubulin ring complex
9QVN 4.7 Å, Cryo-EM reconstruction of the NEDD1 anchor protein bound to the gamma-tubulin ring complex
7QJ0 5.32 Å, Structure of recombinant human gamma-Tubulin Ring Complex 6-spoked assembly intermediate…
9QVM 6.8 Å, Cryo-EM reconstruction of the NEDD1 anchor protein and CDK5RAP2 bound to the…
7QJ1 7.0 Å, Structure of the recombinant human gamma-Tubulin Ring Complex 6-spoked assembly…
8VRD 7.0 Å, Rigid body fitted model for free recombinant gamma tubulin ring complex.
7QJD 7.1 Å, Structure of recombinant human gamma-Tubulin Ring Complex without actin

Browse structure collections

About this viewer

MolViewer shows 6V6B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.