6VO4: Crystal Structure Analysis of BFL1

Crystal Structure Analysis of BFL1. Determined by X-ray diffraction at 1.74 Å resolution. Released 3 Jun 2020.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,089
Mol. weight: 18.6 kDa
Released: 3 Jun 2020

Explore 6VO4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VO4 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	5-20	16
α-helix	32-51	20
α-helix	64-78	15
α-helix	86-106	21
α-helix	115-136	22
α-helix	139	1
α-helix	140-144	5
α-helix	145-148	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2-related protein A1	A	protein	161	Homo sapiens	Q16548 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6VO4_1 Bcl-2-related protein A1 (chains A)
MGHHHHHHSHMTDSEFGYIYRLAQDYLQSVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEK
NLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAP
DVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK

Primary citation

Identification of a Covalent Molecular Inhibitor of Anti-apoptotic BFL-1 by Disulfide Tethering. Harvey, E.P., Hauseman, Z.J., Cohen, D.T. et al. Cell Chem Biol (2020) 27:647. DOI 10.1016/j.chembiol.2020.04.004 · PubMed

Other PDB entries of the same protein (UniProt Q16548 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GIR 1.07 Å, BFL1 covalently bound to inhibitor compound 39
9GIT 1.15 Å, BFL1 covalently bound to inhibitor compound 43
5UUK 1.2 Å, Human Bfl-1 in complex with a Bfl-1-specific selected peptide
5UUL 1.33 Å, Human Bfl-1 in complex with PUMA BH3
9GIS 1.39 Å, BFL1 covalently bound to inhibitor compound 17
9GIQ 1.42 Å, BFL1 covalently bound to inhibitor compound 13
9S6M 1.43 Å, Structure of BFL1 in complex with a covalent inhibitor, alternative series, cmpd25
9GIP 1.46 Å, BFL1 covalently bound to inhibitor compound 7
6E3I 1.48 Å, Human Bfl-1 in complex with the Bfl-1-specific designed peptide srt.F4
6E3J 1.48 Å, Human Bfl-1 in complex with the Bfl-1-specific designed peptide srt.F10
9EW8 1.49 Å, Discovery of a Series of Covalent, Cell Active Bfl-1 Inhibitors
9FKY 1.56 Å, Discovery of a Series of Covalent, Cell Active Bfl-1 Inhibitors

Browse structure collections

About this viewer

MolViewer shows 6VO4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.