6W2X: Inactive GABAB Heterodimer

CryoEM Structure of Inactive GABAB Heterodimer. Determined by electron microscopy at 3.6 Å resolution. Released 1 Jul 2020.

Method: Electron microscopy
Resolution: 3.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,860
Mol. weight: 200.18 kDa
Ligands: MG, SGG, L9Q, NAG
Released: 1 Jul 2020

Explore 6W2X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W2X contains 46 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	51	1	1
β-strand	54-59	6	2
α-helix	72-84	13
β-strand	92	1	1
β-strand	95-100	6	2
α-helix	105-116	12
β-strand	124-127	4	2
α-helix	133-139	7
α-helix	140-142	3
β-strand	146-149	4	2
α-helix	155-158	4
β-strand	166-168	3	2
α-helix	177-186	10
β-strand	191-197	7	3
α-helix	200-213	14
β-strand	219-226	8	3
α-helix	231-238	8
β-strand	244-248	5	3
α-helix	251-264	14
β-strand	272-275	4	3
α-helix	280	1
α-helix	295-298	4
β-strand	306-310	5	3
α-helix	327-334	8
α-helix	350-367	18
α-helix	388-396	9
β-strand	401-403	3	4
β-strand	406-408	3	4
β-strand	410	1	5
β-strand	416	1	5
β-strand	419-424	6	3
β-strand	425	1	6
β-strand	430	1	6
β-strand	434-437	4	3
β-strand	444-445	2	3
β-strand	463-467	5	7
α-helix	474-498	25
α-helix	503-507	5
α-helix	510-525	16
α-helix	528-531	4
α-helix	543-575	33
α-helix	590-614	25
β-strand	621-623	3	7
β-strand	636-642	7	7
α-helix	649-673	25
α-helix	685-708	24
α-helix	715-732	18
α-helix	737-745	9

Chain B: 22 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	55-61	7	8
α-helix	72-75	4
α-helix	78-91	14
β-strand	98-104	7	8
α-helix	110-122	13
β-strand	130-132	3	8
α-helix	136-142	7
β-strand	153-155	3	8
α-helix	162-164	3
β-strand	172-174	3	8
α-helix	183-192	10
β-strand	197-203	7	9
α-helix	206-218	13
β-strand	225-232	8	9
α-helix	237-246	10
β-strand	250-252	3	9
α-helix	257-270	14
β-strand	278-280	3	9
α-helix	305-311	7
β-strand	314-319	6	9
α-helix	335-345	11
α-helix	350-351	2
α-helix	355-377	23
α-helix	393-403	11
β-strand	409-410	2	10
β-strand	413-414	2	10
β-strand	417	1	11
β-strand	422	1	11
β-strand	425-431	7	9
β-strand	436-443	8	9
β-strand	448-450	3	9
β-strand	470-471	2	12
α-helix	482-505	24
α-helix	510-514	5
α-helix	519-538	20
α-helix	546-583	38
α-helix	593-618	26
β-strand	622-627	6	13
β-strand	631	1	12
β-strand	640-641	2	12
β-strand	644-649	6	13
α-helix	654-677	24
α-helix	689-712	24
α-helix	717-749	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid type B receptor subunit 1	A	protein	829	Homo sapiens	Q9UBS5 (AlphaFold model)
Gamma-aminobutyric acid type B receptor subunit 2	B	protein	908	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6W2X_1 Gamma-aminobutyric acid type B receptor subunit 1 (chains A)
DYKDDDDKSHSPHLPRPHSRVPPHPSSERRAVYIGALFPMSGGWPGGQACQPAVEMALED
VNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAAR
MWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEV
FTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEV
YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSI
SNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDF
NYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKD
DLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSH
VRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGY
GSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTI
ETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEK
INDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMR
RLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQS
RQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYKHHHHHH

Sequence of entity 2 (B), FASTA

>6W2X_2 Gamma-aminobutyric acid type B receptor subunit 2 (chains B)
DYKDDDDKWARGAPRPPPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESL
LRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQ
LSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRN
DLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMY
GSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGK
TPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDH
TLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIIN
DTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIK
MSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFA
KTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPD
PAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIG
MSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDA
ATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVT
MQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSR
TCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGVDASCVSPCVSPTASPRHRHVPPS
FRVMVSGL

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
SGG	[(2~{S})-3-[[(1~{S})-1-(3,4-dichlorophenyl)ethyl]amino]-2-oxidanyl-propyl]-(phe…	C18 H22 Cl2 N O3 P	1
L9Q	(1S)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(octadecanoyloxy)methyl…	C41 H80 N O8 P	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structures of metabotropic GABABreceptor. Papasergi-Scott, M.M., Robertson, M.J., Seven, A.B. et al. Nature (2020) 584:310-314. DOI 10.1038/s41586-020-2469-4 · PubMed

Other PDB entries of the same protein (UniProt Q9UBS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PAS 1.62 Å, Heterodimeric coiled-coil structure of human GABA(B) receptor
4MS4 1.9 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR7 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR8 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQF 2.22 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS1 2.25 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQE 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor in the apo form
4MR9 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS3 2.5 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MRM 2.86 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
7C7S 2.9 Å, Cryo-EM structure of the CGP54626-bound human GABA(B) receptor in inactive state.
7C7Q 3.0 Å, Cryo-EM structure of the baclofen/BHFF-bound human GABA(B) receptor in active state

Browse structure collections

About this viewer

MolViewer shows 6W2X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.