6W2Y: GABAB1b Homodimer

CryoEM Structure of GABAB1b Homodimer. Determined by electron microscopy at 3.2 Å resolution. Released 1 Jul 2020.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 9,721
Mol. weight: 192.43 kDa
Ligands: NAG, MG, L9Q, SGG
Released: 1 Jul 2020

Explore 6W2Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W2Y contains 52 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	51-59	9	1
α-helix	72-84	13
β-strand	92-100	9	1
α-helix	105-114	10
β-strand	122-127	6	1
α-helix	130-138	9
β-strand	146-149	4	1
α-helix	155-158	4
β-strand	166-168	3	1
α-helix	174-176	3
α-helix	177-187	11
β-strand	191-196	6	2
α-helix	202-214	13
β-strand	219-225	7	2
α-helix	231-239	9
β-strand	244-248	5	2
α-helix	251-261	11
β-strand	272-276	5	2
α-helix	280	1
α-helix	295-299	5
β-strand	306-310	5	2
α-helix	326-334	9
α-helix	350-367	18
α-helix	388-397	10
β-strand	400-403	4	3
β-strand	406-409	4	3
β-strand	410	1	4
β-strand	416	1	4
β-strand	419-425	7	2
β-strand	430-437	8	2
β-strand	444	1	2
β-strand	463-467	5	5
α-helix	468	1
α-helix	474-497	24
α-helix	503-507	5
α-helix	510-525	16
α-helix	542-573	32
α-helix	593-614	22
β-strand	619-623	5	5
β-strand	636-644	9	5
α-helix	649-673	25
α-helix	688-708	21
α-helix	709-711	3
α-helix	716-735	20
α-helix	737-743	7

Chain B: 27 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	51-59	9	6
α-helix	72-83	12
β-strand	92-100	9	6
α-helix	105-114	10
β-strand	122-127	6	6
α-helix	130-137	8
β-strand	146-149	4	6
α-helix	155-157	3
β-strand	166-168	3	6
α-helix	174-176	3
α-helix	177-187	11
β-strand	191-192	2	7
β-strand	193-196	4	8
α-helix	202-214	13
β-strand	219-220	2	7
α-helix	232-239	8
β-strand	244-248	5	8
α-helix	251-261	11
β-strand	272-276	5	8
α-helix	280	1
α-helix	295-298	4
β-strand	305-310	6	8
α-helix	326-334	9
α-helix	350-367	18
α-helix	388-397	10
β-strand	402-403	2	9
β-strand	406-407	2	9
β-strand	419-425	7	8
β-strand	430-437	8	8
β-strand	444	1	8
β-strand	463-468	6	10
α-helix	474-498	25
α-helix	503-506	4
α-helix	510-525	16
α-helix	529-531	3
α-helix	542-557	16
α-helix	558-562	5
α-helix	563-574	12
α-helix	592-614	23
β-strand	619-623	5	10
α-helix	624-626	3
β-strand	627	1	10
β-strand	636-644	9	10
α-helix	649-673	25
α-helix	686-708	23
α-helix	709-711	3
α-helix	716-743	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid type B receptor subunit 1	A, B	protein	829	Homo sapiens	Q9UBS5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6W2Y_1 Gamma-aminobutyric acid type B receptor subunit 1 (chains A, B)
DYKDDDDKSHSPHLPRPHSRVPPHPSSERRAVYIGALFPMSGGWPGGQACQPAVEMALED
VNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAAR
MWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEV
FTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEV
YKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSI
SNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDF
NYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKD
DLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSH
VRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGY
GSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTI
ETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEK
INDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMR
RLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQS
RQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4
MG	Magnesium ion	Mg	2
L9Q	(1S)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(octadecanoyloxy)methyl…	C41 H80 N O8 P	2
SGG	[(2~{S})-3-[[(1~{S})-1-(3,4-dichlorophenyl)ethyl]amino]-2-oxidanyl-propyl]-(phe…	C18 H22 Cl2 N O3 P	2

Primary citation

Structures of metabotropic GABABreceptor. Papasergi-Scott, M.M., Robertson, M.J., Seven, A.B. et al. Nature (2020) 584:310-314. DOI 10.1038/s41586-020-2469-4 · PubMed

Other PDB entries of the same protein (UniProt Q9UBS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PAS 1.62 Å, Heterodimeric coiled-coil structure of human GABA(B) receptor
4MS4 1.9 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR7 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR8 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQF 2.22 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS1 2.25 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQE 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor in the apo form
4MR9 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS3 2.5 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MRM 2.86 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
7C7S 2.9 Å, Cryo-EM structure of the CGP54626-bound human GABA(B) receptor in inactive state.
7C7Q 3.0 Å, Cryo-EM structure of the baclofen/BHFF-bound human GABA(B) receptor in active state

Browse structure collections

About this viewer

MolViewer shows 6W2Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.