6WDP: Interleukin 12 receptor subunit beta-1

Interleukin 12 receptor subunit beta-1. Determined by X-ray diffraction at 2.01 Å resolution. Released 24 Feb 2021.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,706
Mol. weight: 25.07 kDa
Released: 24 Feb 2021

Explore 6WDP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WDP contains 6 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	1
α-helix	37-39	3
β-strand	46-54	9	2
β-strand	59-67	9	2
β-strand	74-80	7	1
β-strand	86-92	7	1
β-strand	96-100	5	2
β-strand	110-119	10	1
β-strand	122-125	4	1
α-helix	126-128	3
β-strand	129-132	4	1
α-helix	133-135	3
β-strand	147-151	5	3
β-strand	154-160	7	3
α-helix	161-162	2
β-strand	168-175	8	4
β-strand	182-189	8	4
β-strand	193-199	7	3
β-strand	206-214	9	4
α-helix	224-226	3
α-helix	228	1
β-strand	229-231	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-12 receptor subunit beta-1	A	protein	219	Homo sapiens	P42701 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6WDP_1 Interleukin-12 receptor subunit beta-1 (chains A)
SECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRC
CYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDI
KVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQ
EFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPHHHHHH

Primary citation

Structural basis for IL-12 and IL-23 receptor sharing reveals a gateway for shaping actions on T versus NK cells. Glassman, C.R., Mathiharan, Y.K., Jude, K.M. et al. Cell (2021) 184:983-999.e24. DOI 10.1016/j.cell.2021.01.018 · PubMed

Other PDB entries of the same protein (UniProt P42701 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C7M 2.56 Å, Interleukin 12 receptor subunit beta-1 Fn domains in complex with antagonistic FAb…
6WDQ 3.4 Å, IL23/IL23R/IL12Rb1 signaling complex
8YI7 3.57 Å, The Cryo-EM structure of IL-12, receptor subunit beta-1 and receptor subunit beta-2…
8OE4 3.6 Å, Cryo-EM structure of a pre-dimerized human IL-23 complete extracellular signaling complex.
8XRP 3.75 Å, The Cryo-EM structure of IL-12, receptor subunit beta-1 and receptor subunit beta-2…
8ODX 4.4 Å, Interleukin 12 receptor subunit beta-1 Fn domains in complex with antagonistic FAb4…

Browse structure collections

About this viewer

MolViewer shows 6WDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.