Interleukin 12 receptor subunit beta-1. Determined by X-ray diffraction at 2.01 Å resolution. Released 24 Feb 2021.
Explore 6WDP in 3D Show helices and sheets RCSB PDB PDBe
6WDP contains 6 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30 | 1 | 1 |
| α-helix | 37-39 | 3 | |
| β-strand | 46-54 | 9 | 2 |
| β-strand | 59-67 | 9 | 2 |
| β-strand | 74-80 | 7 | 1 |
| β-strand | 86-92 | 7 | 1 |
| β-strand | 96-100 | 5 | 2 |
| β-strand | 110-119 | 10 | 1 |
| β-strand | 122-125 | 4 | 1 |
| α-helix | 126-128 | 3 | |
| β-strand | 129-132 | 4 | 1 |
| α-helix | 133-135 | 3 | |
| β-strand | 147-151 | 5 | 3 |
| β-strand | 154-160 | 7 | 3 |
| α-helix | 161-162 | 2 | |
| β-strand | 168-175 | 8 | 4 |
| β-strand | 182-189 | 8 | 4 |
| β-strand | 193-199 | 7 | 3 |
| β-strand | 206-214 | 9 | 4 |
| α-helix | 224-226 | 3 | |
| α-helix | 228 | 1 | |
| β-strand | 229-231 | 3 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Interleukin-12 receptor subunit beta-1 | A | protein | 219 | Homo sapiens | P42701 (AlphaFold model) |
>6WDP_1 Interleukin-12 receptor subunit beta-1 (chains A) SECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRC CYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDI KVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQ EFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPHHHHHH
Structural basis for IL-12 and IL-23 receptor sharing reveals a gateway for shaping actions on T versus NK cells. Glassman, C.R., Mathiharan, Y.K., Jude, K.M. et al. Cell (2021) 184:983-999.e24. DOI 10.1016/j.cell.2021.01.018 · PubMed
Other PDB entries of the same protein (UniProt P42701 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6WDP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.