6WIV: Human GABA(B) receptor in an inactive state

Structure of human GABA(B) receptor in an inactive state. Determined by electron microscopy at 3.3 Å resolution. Released 1 Jul 2020.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 11,206
Mol. weight: 191.24 kDa
Ligands: U3G, CLR, U3D, CA
Released: 1 Jul 2020

Explore 6WIV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WIV contains 56 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	51-59	9	1
α-helix	68-84	17
β-strand	92-100	9	1
α-helix	105-116	12
α-helix	121	1
β-strand	122-127	6	1
α-helix	130-139	10
α-helix	140-142	3
β-strand	146-149	4	1
α-helix	155-158	4
β-strand	166-168	3	1
α-helix	171-172	2
α-helix	173-175	3
α-helix	176-187	12
β-strand	191-197	7	2
α-helix	200-215	16
β-strand	219-226	8	2
α-helix	231-240	10
β-strand	244-248	5	2
α-helix	251-264	14
β-strand	272-276	5	2
α-helix	283-285	3
α-helix	295-302	8
β-strand	306-310	5	2
α-helix	326-336	11
α-helix	350-367	18
α-helix	378-380	3
α-helix	387-397	11
β-strand	400-403	4	3
β-strand	406-409	4	3
β-strand	410	1	4
β-strand	415	1	1
β-strand	416	1	4
α-helix	417	1
β-strand	419-426	8	2
β-strand	429-437	9	2
β-strand	442-445	4	2
α-helix	456-458	3
β-strand	464-467	4	5
α-helix	472-498	27
α-helix	503-507	5
α-helix	510-525	16
α-helix	527-531	5
α-helix	534-575	42
α-helix	590-614	25
β-strand	619	1	6
β-strand	622-623	2	5
β-strand	637-641	5	5
β-strand	644	1	6
α-helix	649-673	25
α-helix	685-708	24
α-helix	713-746	34

Chain B: 27 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	55-61	7	7
α-helix	71-76	6
α-helix	78-91	14
β-strand	98-104	7	7
α-helix	110-123	14
β-strand	129-132	4	7
α-helix	136-145	10
α-helix	146-148	3
β-strand	153-155	3	7
α-helix	161-164	4
β-strand	172-174	3	7
α-helix	177-178	2
α-helix	179-181	3
α-helix	182-193	12
β-strand	197-203	7	8
α-helix	206-219	14
β-strand	225-232	8	8
α-helix	237-245	9
β-strand	250-254	5	8
α-helix	257-269	13
β-strand	278-282	5	8
α-helix	285-286	2
α-helix	305-311	7
β-strand	315-319	5	8
α-helix	335-345	11
α-helix	350-351	2
α-helix	355-375	21
α-helix	393-404	12
β-strand	407-410	4	9
β-strand	413-416	4	9
β-strand	417-418	2	7
β-strand	421-422	2	7
β-strand	425-432	8	8
β-strand	435-443	9	8
β-strand	448-451	4	8
α-helix	463-465	3
β-strand	474	1	10
α-helix	479-505	27
α-helix	510-514	5
α-helix	517-536	20
α-helix	546-583	38
α-helix	596-618	23
β-strand	622-627	6	10
β-strand	644-649	6	10
α-helix	653-678	26
β-strand	683	1	11
β-strand	686	1	11
α-helix	689-711	23
α-helix	717-747	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid type B receptor subunit 1	A	protein	810	Homo sapiens	Q9UBS5 (AlphaFold model)
Gamma-aminobutyric acid type B receptor subunit 2	B	protein	827	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6WIV_1 Gamma-aminobutyric acid type B receptor subunit 1 (chains A)
MGPGAPFARVGWPLPLLVVMAAGVAPVWASHSPHLPRPHSRVPPHPSSERRAVYIGALFP
MSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDP
IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTR
VKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQ
DARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTE
AVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWAL
ALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWT
LIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSV
LSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRN
QFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLL
VGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYK
GLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFA
SLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRE
LEKIIAEKEERVSELRHQLQSRDYKDDDDK

Sequence of entity 2 (B), FASTA

>6WIV_2 Gamma-aminobutyric acid type B receptor subunit 2 (chains B)
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTDYKDDDDK

Ligands and cofactors

ID	Name	Formula	Copies
U3G	(2R)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-{[(9Z)-octadec-9-enoyl]o…	C43 H76 N O8 P	1
CLR	Cholesterol	C27 H46 O	10
U3D	[(2R)-3-[(Z)-icos-11-enoyl]oxy-2-[(Z)-octadec-9-enoyl]oxypropyl]…	C46 H88 N O8 P	1
CA	Calcium ion	Ca	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Structure of human GABABreceptor in an inactive state. Park, J., Fu, Z., Frangaj, A. et al. Nature (2020) 584:304-309. DOI 10.1038/s41586-020-2452-0 · PubMed

Other PDB entries of the same protein (UniProt Q9UBS5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PAS 1.62 Å, Heterodimeric coiled-coil structure of human GABA(B) receptor
4MS4 1.9 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR7 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MR8 2.15 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQF 2.22 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS1 2.25 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MQE 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor in the apo form
4MR9 2.35 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MS3 2.5 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
4MRM 2.86 Å, Crystal structure of the extracellular domain of human GABA(B) receptor bound to the…
7C7S 2.9 Å, Cryo-EM structure of the CGP54626-bound human GABA(B) receptor in inactive state.
7C7Q 3.0 Å, Cryo-EM structure of the baclofen/BHFF-bound human GABA(B) receptor in active state

Browse structure collections

About this viewer

MolViewer shows 6WIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.