6WLG: Ints3 C-terminal Domain

Ints3 C-terminal Domain. Determined by X-ray diffraction at 3.11 Å resolution. Released 2 Dec 2020.

Method: X-ray diffraction
Resolution: 3.11 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,750
Mol. weight: 97.93 kDa
Released: 2 Dec 2020

Explore 6WLG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WLG contains 51 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 0 β-strands

Element	Residues	Length
α-helix	577-585	9
α-helix	595-604	10
α-helix	613-623	11
α-helix	644-648	5
α-helix	653-659	7
α-helix	673-682	10
α-helix	686-694	9
α-helix	705-711	7
α-helix	720-733	14
α-helix	735-748	14
α-helix	750-753	4
α-helix	758-766	9
α-helix	769-780	12
α-helix	792-799	8
α-helix	804-816	13
α-helix	821-829	9
α-helix	837-847	11
α-helix	851-853	3
α-helix	854-861	8
α-helix	871-882	12
α-helix	884-895	12
α-helix	920-934	15
α-helix	940-943	4
α-helix	945-956	12
α-helix	960-965	6
α-helix	967-971	5

Chain B: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	577-585	9
α-helix	595-604	10
α-helix	614-623	10
α-helix	653-659	7
α-helix	673-682	10
α-helix	686-694	9
α-helix	705-711	7
α-helix	720-733	14
α-helix	735-748	14
α-helix	750-753	4
α-helix	758-766	9
α-helix	769-780	12
α-helix	792-799	8
α-helix	804-816	13
α-helix	821-829	9
α-helix	837-847	11
α-helix	851-853	3
α-helix	854-861	8
α-helix	871-882	12
α-helix	884-895	12
α-helix	920-934	15
α-helix	940-943	4
α-helix	945-955	11
α-helix	962-966	5
α-helix	967-972	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrator complex subunit 3	A, B	protein	423	Homo sapiens	Q68E01 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6WLG_1 Integrator complex subunit 3 (chains A, B)
HPIKETVVEEPVDITPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSE
QLSVLASCLQELFKAHFRGEVLPEEITEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLL
DLLSELYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQED
DVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVL
NILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPS
EEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSS
KLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLA
EEY

Primary citation

Structural basis for multifunctional roles of human Ints3 C-terminal domain. Li, J., Ma, X., Banerjee, S. et al. J Biol Chem (2020) 296:100112-100112. DOI 10.1074/jbc.RA120.016393 · PubMed

Other PDB entries of the same protein (UniProt Q68E01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OWT 2.0 Å, Structural basis of SOSS1 complex assembly
4OWW 2.3 Å, Structural basis of SOSS1 in complex with a 35nt ssDNA
4OWX 2.3 Å, Structural basis of SOSS1 in complex with a 12nt ssDNA
7BV7 2.4 Å, INTS3 complexed with INTS6
8HPP 3.0 Å, Crystal structure of human INTS3 with SAGE1
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex

Browse structure collections

About this viewer

MolViewer shows 6WLG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.