7BV7: INTS3

INTS3 complexed with INTS6. Determined by X-ray diffraction at 2.4 Å resolution. Released 14 Jul 2021.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 3
Atoms: 6,182
Mol. weight: 111.24 kDa
Released: 14 Jul 2021

Explore 7BV7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BV7 contains 60 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 29 helices, 0 β-strands

Element	Residues	Length
α-helix	596-606	11
α-helix	617-626	10
α-helix	643-649	7
α-helix	653-660	8
α-helix	672-683	12
α-helix	687-697	11
α-helix	706-713	8
α-helix	720-734	15
α-helix	736-749	14
α-helix	752-755	4
α-helix	759-765	7
α-helix	770-781	12
α-helix	793-800	8
α-helix	805-817	13
α-helix	822-825	4
α-helix	826-830	5
α-helix	838-848	11
α-helix	852-853	2
α-helix	856-862	7
α-helix	865-866	2
α-helix	872-883	12
α-helix	885-897	13
α-helix	921-934	14
α-helix	935-937	3
α-helix	942-944	3
α-helix	946-955	10
α-helix	956-958	3
α-helix	961-966	6
α-helix	968-971	4

Chain B: 27 helices, 0 β-strands

Element	Residues	Length
α-helix	594-608	15
α-helix	617-626	10
α-helix	652-662	11
α-helix	668-683	16
α-helix	687-697	11
α-helix	706-714	9
α-helix	720-734	15
α-helix	736-749	14
α-helix	751-754	4
α-helix	758-767	10
α-helix	770-781	12
α-helix	793-800	8
α-helix	805-816	12
α-helix	822-825	4
α-helix	826-831	6
α-helix	838-848	11
α-helix	855-862	8
α-helix	865-866	2
α-helix	872-883	12
α-helix	885-898	14
α-helix	921-934	14
α-helix	935-937	3
α-helix	942-944	3
α-helix	946-955	10
α-helix	956-958	3
α-helix	961-966	6
α-helix	968-971	4

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	809-820	12
α-helix	828-834	7
α-helix	841-857	17
α-helix	861-880	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrator complex subunit 3	A, B	protein	436	Homo sapiens	Q68E01 (AlphaFold model)
Integrator complex subunit 6	C	protein	88	Homo sapiens	Q9UL03 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7BV7_1 Integrator complex subunit 3 (chains A, B)
TVVEEPVDITPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSEQLSVL
ASCLQELFKAHFRGEVLPEEITEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSE
LYQKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLL
CHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQ
SLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVK
MVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQL
TLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYED
SSTKPPKSRRKAALSS

Sequence of entity 2 (C), FASTA

>7BV7_2 Integrator complex subunit 6 (chains C)
MHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFK
KRMLIEQLENFLDEIHRRANQINHINSN

Primary citation

Crystal structure of the INTS3/INTS6 complex reveals the functional importance of INTS3 dimerization in DSB repair. Jia, Y., Cheng, Z., Bharath, S.R. et al. Cell Discov (2021) 7:66-66. DOI 10.1038/s41421-021-00283-0 · PubMed

Other PDB entries of the same protein (UniProt Q68E01 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OWT 2.0 Å, Structural basis of SOSS1 complex assembly
4OWW 2.3 Å, Structural basis of SOSS1 in complex with a 35nt ssDNA
4OWX 2.3 Å, Structural basis of SOSS1 in complex with a 12nt ssDNA
8HPP 3.0 Å, Crystal structure of human INTS3 with SAGE1
6WLG 3.11 Å, Ints3 C-terminal Domain
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex

Browse structure collections

About this viewer

MolViewer shows 7BV7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.