6X5Q: PDB entry 6X5Q

Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluA1. Determined by X-ray diffraction at 2.14 Å resolution. Released 23 Dec 2020.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,355
Mol. weight: 33.15 kDa
Released: 23 Dec 2020

Explore 6X5Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6X5Q contains 17 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-12	4
β-strand	13-22	10	1
β-strand	25-32	8	1
β-strand	37-45	9	1
α-helix	46-48	3
α-helix	51-66	16
β-strand	72	1	2
α-helix	73-74	2
β-strand	75-81	7	1
β-strand	84-89	6	1
β-strand	96	1	2
α-helix	97-104	8
α-helix	109-128	20
β-strand	131-132	2	3
α-helix	138-140	3
β-strand	141-143	3	2
β-strand	152-154	3	2
α-helix	157-159	3
β-strand	161-162	2	3
β-strand	169	1	4
α-helix	177-179	3
α-helix	182-185	4
β-strand	190	1	4
α-helix	193-208	16
α-helix	218-226	9
α-helix	242-251	10
α-helix	260-261	2
α-helix	262-266	5
α-helix	269-272	4

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	819-822	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium/calmodulin-dependent protein kinase type II subunit alpha	A	protein	268	Homo sapiens	Q9UQM7 (AlphaFold model)
Glutamate receptor 1	B	protein	20	Homo sapiens	P42261 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6X5Q_1 Calcium/calmodulin-dependent protein kinase type II subunit alpha (chains A)
TRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRL
LKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHC
HQMGVVHRNLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLR
KDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKD
LINKMLTINPSKRITAAEALKHPWISHR

Sequence of entity 2 (B), FASTA

>6X5Q_2 Glutamate receptor 1 (chains B)
SKRMKGFCLIPQQSINEAIR

Primary citation

CaMKII binds both substrates and activators at the active site. Ozden, C., Sloutsky, R., Mitsugi, T. et al. Cell Rep (2022) 40:111064-111064. DOI 10.1016/j.celrep.2022.111064 · PubMed

Other PDB entries of the same protein (UniProt Q9UQM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6X5G 1.85 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and LRRC7 inhibitory…
7UJR 1.95 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
6OF8 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7UJT 2.1 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D) in…
9EOY 2.1 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7REC 2.2 Å, Structure of Thr354Asn, Glu355Gln, Thr412Asn, Ile414Met, Ile464His, and Phe467Met mutant…
7UJQ 2.25 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B
2VZ6 2.3 Å, Structure of human calcium calmodulin dependent protein kinase type II alpha (CAMK2A) in…
7KL0 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
7KL1 2.4 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)
6VZK 2.55 Å, Crystal structure of human CaMKII-alpha (CAMK2A)kinase domain
7KL2 2.56 Å, Cocrystal structure of human CaMKII-alpha (CAMK2A)kinase domain and GluN2B(S1303D)

Browse structure collections

About this viewer

MolViewer shows 6X5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.