Crystal structure of the c-Src SH3 domain H122R-Q128E mutant in complex with Ni(II) at pH 7.5 co-crystallized with methyl beta-cyclodextrin. Determined by X-ray diffraction at 1.05 Å resolution. Released 22 Apr 2020.
Explore 6XX4 in 3D Show helices and sheets RCSB PDB PDBe
6XX4 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85-88 | 4 | 1 |
| β-strand | 92 | 1 | 2 |
| β-strand | 99 | 1 | 1 |
| α-helix | 100-101 | 2 | |
| β-strand | 102 | 1 | 2 |
| β-strand | 107-110 | 4 | 1 |
| β-strand | 118-123 | 6 | 1 |
| β-strand | 129-133 | 5 | 1 |
| α-helix | 134-136 | 3 | |
| β-strand | 137-139 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Proto-oncogene tyrosine-protein kinase Src | A | protein | 61 | Gallus gallus | P00523 (AlphaFold model) |
>6XX4_1 Proto-oncogene tyrosine-protein kinase Src (chains A) GSHMTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLTTGETGYIPSNYVAPS D
| ID | Name | Formula | Copies |
|---|---|---|---|
| NI | Nickel (II) ion | Ni | 1 |
The effect of an engineered ATCUN motif on the structure and biophysical properties of the SH3 domain of c-Src tyrosine kinase. Plaza-Garrido, M., Salinas-Garcia, M.C., Martinez, J.C. et al. J Biol Inorg Chem (2020) 25:621-634. DOI 10.1007/s00775-020-01785-0 · PubMed
Other PDB entries of the same protein (UniProt P00523 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6XX4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.