6XXX: Calmodulin-1

1.25 Angstrom crystal structure of Ca/CaM A102V:RyR2 peptide complex. Determined by X-ray diffraction at 1.25 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,621
Mol. weight: 19.55 kDa
Ligands: CA
Released: 10 Feb 2021

Explore 6XXX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XXX contains 9 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-20	14
β-strand	27-28	2	1
α-helix	30-39	10
α-helix	46-56	11
β-strand	64-65	2	1
α-helix	66-76	11
α-helix	82-93	12
β-strand	100-101	2	2
α-helix	103-112	10
α-helix	119-129	11
β-strand	137-138	2	2
α-helix	139-146	8

Chain BBB: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-18	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin-1	AAA	protein	149	Homo sapiens	P0DP23 (AlphaFold model)
Lys-lys-ala-val-trp-his-lys-leu-leu-ser-lys-gln-arg-lys-arg-ala-val-val-ala-cys-phe	BBB	protein	21	Homo sapiens

Sequence of entity 1 (AAA), FASTA

>6XXX_1 Calmodulin-1 (chains AAA)
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISVAELRHVMTNLGEKLTDE
EVDEMIREADIDGDGQVNYEEFVQMMTAK

Sequence of entity 2 (BBB), FASTA

>6XXX_2 LYS-LYS-ALA-VAL-TRP-HIS-LYS-LEU-LEU-SER-LYS-GLN-ARG-LYS-ARG-ALA-VAL-VAL-ALA-CYS-PHE (chains BBB)
KKAVWHKLLSKQRKRAVVACF

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

CPVT-associated calmodulin variants N53I and A102V dysregulate Ca2+ signalling via different mechanisms. Prakash, O., Held, M., McCormick, L.F. et al. J Cell Sci (2022) 135. DOI 10.1242/jcs.258796 · PubMed

Other PDB entries of the same protein (UniProt P0DP23 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MXD 1.17 Å, Human E104A calmodulin:MLCK RM20 complex
7BF1 1.24 Å, Ca2+-Calmodulin in complex with peptide from brain-type creatine kinase in extended 1:2…
4DJC 1.35 Å, 1.35 A crystal structure of the NaV1.5 DIII-IV-Ca/CaM complex
7BF2 1.43 Å, Ca2+-Calmodulin in complex with human muscle form creatine kinase peptide in extended…
2F3Y 1.45 Å, Calmodulin/IQ domain complex
2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
4LZX 1.5 Å, Complex of IQCG and Ca2+-free CaM
5V03 1.58 Å, A positive allosteric modulator binding pocket in SK2 ion channels is shared by Riluzole…
9MVW 1.58 Å, Crystal structure of S101F calmodulin - CaM:RM20 analog complex
2F3Z 1.6 Å, Calmodulin/IQ-AA domain complex
6M7H 1.6 Å, Structure of calmodulin with KN93
6DAD 1.65 Å, 1.65 Angstrom crystal structure of the N97I Ca/CaM:CaV1.2 IQ domain complex

Browse structure collections

About this viewer

MolViewer shows 6XXX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.