Crystal structure of Whirlin PDZ3_C-ter in complex with CASK internal PDZ binding motif peptide. Determined by X-ray diffraction at 1.63 Å resolution. Released 7 Oct 2020.
Explore 6Y9O in 3D Show helices and sheets RCSB PDB PDBe
6Y9O contains 2 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 814-819 | 6 | 1 |
| β-strand | 827-830 | 4 | 1 |
| β-strand | 841-845 | 5 | 1 |
| α-helix | 850-854 | 5 | |
| β-strand | 862-866 | 5 | 1 |
| β-strand | 869-870 | 2 | 1 |
| α-helix | 876-888 | 13 | |
| β-strand | 894-900 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 922-925 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Whirlin | A | protein | 105 | Mus musculus | Q80VW5 (AlphaFold model) |
| Peripheral plasma membrane protein CASK | C | protein | 12 | Mus musculus | O70589 (AlphaFold model) |
>6Y9O_1 Whirlin (chains A) GAMGSTSLEPTSTLVRVRKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGH VILEVNGQTLRGKEHKEAARIIAEAFKTKERDYIDFLVTEFNVML
>6Y9O_2 Peripheral plasma membrane protein CASK (chains C) TAPQWVPVSWVY
Deciphering the Unexpected Binding Capacity of the Third PDZ Domain of Whirlin to Various Cochlear Hair Cell Partners. Zhu, Y., Delhommel, F., Cordier, F. et al. J Mol Biol (2020) 432:5920-5937. DOI 10.1016/j.jmb.2020.09.012 · PubMed
Other PDB entries of the same protein (UniProt Q80VW5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Y9O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.