6YF5: PDB entry 6YF5

Lamin A 17-70 coil1A dimer stabilized by C-terminal capping. Determined by X-ray diffraction at 1.83 Å resolution. Released 2 Sept 2020.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,872
Mol. weight: 42.43 kDa
Released: 2 Sept 2020

Explore 6YF5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YF5 contains 13 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	25-27	3	1
α-helix	28-86	59
α-helix	88-90	3
α-helix	93-102	10

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	25-27	3	1
α-helix	28-86	59
α-helix	88-90	3
α-helix	93-103	11

Chain C: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	22-25	4
β-strand	26	1	2
α-helix	28-34	7
α-helix	36-86	51
α-helix	93-103	11

Chain D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	26	1	2
α-helix	28-86	59
α-helix	88-90	3
α-helix	93-103	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prelamin-A/C,Microtubule-associated protein RP/EB family member 1	A, B, C, D	protein	91	Homo sapiens	P02545 (AlphaFold model), Q15691 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6YF5_1 Prelamin-A/C,Microtubule-associated protein RP/EB family member 1 (chains A, B, C, D)
SSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVDFYFGK
LRNIELICQENEGENDPVLQRIVDILYATDE

Primary citation

Addressing the Molecular Mechanism of Longitudinal Lamin Assembly Using Chimeric Fusions. Stalmans, G., Lilina, A.V., Vermeire, P.J. et al. Cells (2020) 9. DOI 10.3390/cells9071633 · PubMed

Other PDB entries of the same protein (UniProt P02545 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WZZ 1.3 Å, Crystal structure of peptide KAGQVVTIW in complex with HLA-B5801
7X1B 1.4 Å, Crystal structure of peptide KAGQVVTI in complex with HLA-B5801
1IFR 1.4 Å, Structure of Lamin A/C Globular Domain
3GEF 1.5 Å, Crystal structure of the R482W mutant of lamin A/C
8I33 1.62 Å, Coil 1a of lamin A (residue 25-65)
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
7CRG 1.8 Å, Beta-strand-mediated dimeric formation of the extended Ig-like domains of human lamin A/C
7X5D 1.82 Å, Crystal Structure of the K316C mutant of Human Lamin A/C Coil 2 (residues 244-340)
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
7YVD 2.1 Å, The crystal structure of the progerin C-terminal peptide and the Ig-like domain of lamin…
1X8Y 2.2 Å, Human lamin coil 2B
6RPR 2.26 Å, LEM domain of Emerin mutant T43I in complex with BAF dimer and the Igfold of the lamin A/C

Browse structure collections

About this viewer

MolViewer shows 6YF5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.