UvrD helicase RNA polymerase interactions are governed by UvrDs carboxy terminal Tudor domain. Determined by solution NMR. Released 21 Oct 2020.
Explore 6YI2 in 3D Show helices and sheets RCSB PDB PDBe
6YI2 contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 675-678 | 4 | 1 |
| β-strand | 682-690 | 9 | 1 |
| α-helix | 693-695 | 3 | |
| β-strand | 697-702 | 6 | 1 |
| β-strand | 707-711 | 5 | 1 |
| α-helix | 712-715 | 4 | |
| α-helix | 717 | 1 | |
| β-strand | 718-719 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA helicase | A | protein | 76 | Escherichia coli | P03018 (AlphaFold model) |
>6YI2_1 DNA helicase (chains A) RLRATVSRPVSHQRMGTPMVENDSGYKLGQRVRHAKFGEGTIVNMEGSGEHSRLQVAFQG QGIKWLVAAYARLESV
UvrD helicase-RNA polymerase interactions are governed by UvrD's carboxy-terminal Tudor domain. Kawale, A.A., Burmann, B.M. Commun Biol (2020) 3:607-607. DOI 10.1038/s42003-020-01332-2 · PubMed
Other PDB entries of the same protein (UniProt P03018 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6YI2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.