6YIO: FAB RG6292

Crystal structure of FAB RG6292 in complex with CD25 ecd. Determined by X-ray diffraction at 1.83 Å resolution. Released 11 Nov 2020.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,924
Mol. weight: 70.26 kDa
Released: 11 Nov 2020

Explore 6YIO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YIO contains 22 α-helices and 61 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
α-helix	6-9	4
β-strand	13-16	4	2
β-strand	20-21	2	3
β-strand	25-27	3	4
β-strand	30	1	5
α-helix	36-37	2
β-strand	43-48	6	4
β-strand	53-56	4	4
β-strand	99	1	4
β-strand	103-104	2	3
α-helix	105-109	5
β-strand	113	1	5
β-strand	119-120	2	4
β-strand	122	1	1
β-strand	126-131	6	2
α-helix	132	1
β-strand	137	1	6
β-strand	144-146	3	2
β-strand	147-150	4	7
β-strand	153-156	4	7
β-strand	163	1	6

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	8
α-helix	7-9	3
β-strand	10-12	3	9
β-strand	18-25	8	8
β-strand	34-39	6	9
β-strand	46-51	6	9
β-strand	58-60	3	9
α-helix	62-64	3
β-strand	68-73	6	8
β-strand	78-83	6	8
α-helix	88-90	3
β-strand	92-99	8	9
β-strand	109-112	4	9
β-strand	116-120	5	9
β-strand	126	1	10
α-helix	127-128	2
β-strand	129-133	5	11
β-strand	144-154	11	11
β-strand	155	1	10
β-strand	160-163	4	12
α-helix	164-166	3
β-strand	168	1	12
β-strand	172-174	3	11
α-helix	175-177	3
β-strand	178-179	2	11
β-strand	185-194	10	11
α-helix	195-197	3
β-strand	203-209	7	12
α-helix	210-212	3
β-strand	214-220	7	12

Chain L: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	13
β-strand	10-13	4	14
β-strand	19-25	7	13
β-strand	33-38	6	14
β-strand	45-49	5	14
β-strand	53-54	2	14
α-helix	55	1
β-strand	62-67	6	13
β-strand	70-75	6	13
α-helix	80-82	3
β-strand	85-90	6	14
α-helix	96	1
β-strand	97-98	2	14
β-strand	102-106	5	14
β-strand	111	1	15
α-helix	112-113	2
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	16
β-strand	140	1	15
β-strand	145-150	6	17
β-strand	153-154	2	17
α-helix	155	1
β-strand	159-163	5	16
α-helix	164-167	4
β-strand	173-182	10	16
α-helix	183-187	5
β-strand	191-197	7	17
β-strand	205-210	6	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-2 receptor subunit alpha	B	protein	203	Homo sapiens	P01589 (AlphaFold model)
FAB fragment heavy chain	H	protein	227	Homo sapiens
FAB frgament light chain	L	protein	214	Homo sapiens

Sequence of entity 1 (B), FASTA

>6YIO_1 Interleukin-2 receptor subunit alpha (chains B)
ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQ
CTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYH
FVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQA
SPEGRPESETSCAHHHHHHHHHH

Sequence of entity 2 (H), FASTA

>6YIO_2 FAB FRAGMENT HEAVY CHAIN (chains H)
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSLAISWVRQAPGQGLEWMGGIIPIFGTANY
AQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGGSVSGTLVDFDIWGQGTMVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK

Sequence of entity 3 (L), FASTA

>6YIO_3 FAB FRGAMENT LIGHT CHAIN (chains L)
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYNIYPITFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Primary citation

CD25-T reg -depleting antibodies preserving IL-2 signaling on effector T cells enhance effector activation and antitumor immunity. Solomon, I., Amann, M., Goubier, A. et al. Nat Cancer (2020) 1:1153-1166. DOI 10.1038/s43018-020-00133-0 · PubMed

Other PDB entries of the same protein (UniProt P01589 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2B5I 2.3 Å, cytokine receptor complex
1Z92 2.8 Å, structure of interleukin-2 with its alpha receptor
3NFP 2.86 Å, Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with…
3IU3 2.9 Å, Crystal structure of the Fab fragment of therapeutic antibody Basiliximab in complex…
9KMC 2.97 Å, Cryo-EM structure of the heterotrimeric interleukin-2 receptor in complex with…
2ERJ 3.0 Å, Crystal structure of the heterotrimeric interleukin-2 receptor in complex with…
7F9W 3.2 Å, CD25 in complex with Fab
7ZMZ 3.2 Å, Engineered Interleukin 2 bound to CD25 receptor
6VWU 3.4 Å, X-ray structure of ALKS 4230, a fusion of circularly permuted human Interleukin-2 and…

Browse structure collections

About this viewer

MolViewer shows 6YIO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.