14-3-3 zeta bound to the phosphorylated 18E6 C-terminus. Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Feb 2021.
Explore 6ZFD in 3D Show helices and sheets RCSB PDB PDBe
6ZFD contains 30 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-68 | 31 | |
| α-helix | 73-100 | 28 | |
| α-helix | 101-105 | 5 | |
| α-helix | 106-108 | 3 | |
| α-helix | 112-132 | 21 | |
| α-helix | 138-159 | 22 | |
| α-helix | 165-176 | 12 | |
| α-helix | 177-181 | 5 | |
| α-helix | 185-200 | 16 | |
| α-helix | 203-205 | 3 | |
| α-helix | 208-229 | 22 | |
| α-helix | 235-236 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 35-37 | 3 | |
| α-helix | 38-67 | 30 | |
| α-helix | 74-100 | 27 | |
| α-helix | 101-105 | 5 | |
| α-helix | 106-108 | 3 | |
| α-helix | 112-132 | 21 | |
| α-helix | 136-159 | 24 | |
| α-helix | 165-176 | 12 | |
| α-helix | 177-181 | 5 | |
| α-helix | 185-200 | 16 | |
| α-helix | 203-205 | 3 | |
| α-helix | 208-229 | 22 | |
| α-helix | 234-237 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein zeta/delta,Protein E6 | A, B | protein | 243 | Homo sapiens, Human papillomavirus type 18 | P06463 (AlphaFold model), P63104 (AlphaFold model) |
>6ZFD_1 14-3-3 protein zeta/delta,Protein E6 (chains A, B) GPHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRS AWRVVSSIEQKTEGAAAAQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISAAAMQPTHPIRLGLALNFSVF YYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTGGGGRRRE TQV
Hierarchized phosphotarget binding by the seven human 14-3-3 isoforms. Gogl, G., Tugaeva, K.V., Eberling, P. et al. Nat Commun (2021) 12:1677-1677. DOI 10.1038/s41467-021-21908-8 · PubMed
Other PDB entries of the same protein (UniProt P06463 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ZFD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.