Spike Protein of RaTG13 Bat Coronavirus in Closed Conformation. Determined by electron microscopy at 3.1 Å resolution. Released 1 Jul 2020.
Explore 6ZGF in 3D Show helices and sheets RCSB PDB PDBe
6ZGF contains 102 α-helices and 207 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 27-31 | 5 | 1 |
| β-strand | 33-37 | 5 | 2 |
| β-strand | 48-55 | 8 | 3 |
| β-strand | 60-64 | 5 | 1 |
| β-strand | 84-85 | 2 | 4 |
| β-strand | 90-96 | 7 | 1 |
| β-strand | 101-107 | 7 | 4 |
| β-strand | 116-120 | 5 | 4 |
| β-strand | 127-131 | 5 | 4 |
| β-strand | 133-143 | 11 | 4 |
| β-strand | 155-163 | 9 | 4 |
| β-strand | 168-170 | 3 | 4 |
| β-strand | 188-197 | 10 | 1 |
| β-strand | 200-209 | 10 | 1 |
| α-helix | 216-218 | 3 | |
| β-strand | 220-223 | 4 | 2 |
| β-strand | 224-229 | 6 | 1 |
| β-strand | 237-245 | 9 | 4 |
| β-strand | 264-269 | 6 | 1 |
| β-strand | 271-279 | 9 | 3 |
| β-strand | 285-290 | 6 | 3 |
| α-helix | 295-303 | 9 | |
| β-strand | 311 | 1 | 5 |
| β-strand | 314 | 1 | 6 |
| β-strand | 324-328 | 5 | 7 |
| β-strand | 335 | 1 | 8 |
| α-helix | 336 | 1 | |
| β-strand | 349 | 1 | 9 |
| α-helix | 350-352 | 3 | |
| β-strand | 354-358 | 5 | 9 |
| β-strand | 361-362 | 2 | 8 |
| α-helix | 365-368 | 4 | |
| β-strand | 376-379 | 4 | 9 |
| α-helix | 384-386 | 3 | |
| β-strand | 391-392 | 2 | 8 |
| β-strand | 394-403 | 10 | 9 |
| α-helix | 404-409 | 6 | |
| α-helix | 418-421 | 4 | |
| β-strand | 431-437 | 7 | 9 |
| α-helix | 439-442 | 4 | |
| β-strand | 452-454 | 3 | 10 |
| β-strand | 473-474 | 2 | 11 |
| β-strand | 488-489 | 2 | 11 |
| β-strand | 492-494 | 3 | 10 |
| α-helix | 503-505 | 3 | |
| β-strand | 507-516 | 10 | 9 |
| β-strand | 524-525 | 2 | 8 |
| β-strand | 538-543 | 6 | 7 |
| β-strand | 546-554 | 9 | 7 |
| β-strand | 565-567 | 3 | 7 |
| β-strand | 573-577 | 5 | 7 |
| β-strand | 584-588 | 5 | 7 |
| β-strand | 595-598 | 4 | 6 |
| β-strand | 599 | 1 | 5 |
| β-strand | 609-612 | 4 | 6 |
| α-helix | 620-623 | 4 | |
| α-helix | 633-635 | 3 | |
| β-strand | 643-645 | 3 | 6 |
| β-strand | 648-651 | 4 | 6 |
| β-strand | 654-655 | 2 | 12 |
| α-helix | 656 | 1 | |
| β-strand | 664-667 | 4 | 12 |
| β-strand | 670-675 | 6 | 12 |
| β-strand | 687-692 | 6 | 12 |
| α-helix | 693-694 | 2 | |
| β-strand | 697-699 | 3 | 13 |
| β-strand | 707-711 | 5 | 14 |
| β-strand | 714-724 | 11 | 15 |
| β-strand | 729-732 | 4 | 16 |
| α-helix | 734-738 | 5 | |
| α-helix | 757-767 | 11 | |
| α-helix | 769-778 | 10 | |
| β-strand | 783-785 | 3 | 17 |
| α-helix | 787-789 | 3 | |
| α-helix | 803-804 | 2 | |
| α-helix | 808-810 | 3 | |
| α-helix | 813-821 | 9 | |
| α-helix | 833-836 | 4 | |
| α-helix | 846-850 | 5 | |
| β-strand | 854-857 | 4 | 16 |
| α-helix | 858-859 | 2 | |
| α-helix | 863-876 | 14 | |
| α-helix | 883-885 | 3 | |
| α-helix | 894-903 | 10 | |
| α-helix | 909-914 | 6 | |
| α-helix | 916-935 | 20 | |
| α-helix | 938-940 | 3 | |
| α-helix | 946-960 | 15 | |
| α-helix | 961-963 | 3 | |
| α-helix | 982-1024 | 43 | |
| α-helix | 1025-1029 | 5 | |
| β-strand | 1043-1052 | 10 | 15 |
| β-strand | 1055-1065 | 11 | 15 |
| β-strand | 1068-1074 | 7 | 14 |
| β-strand | 1077-1078 | 2 | 18 |
| β-strand | 1083-1086 | 4 | 18 |
| β-strand | 1090-1093 | 4 | 14 |
| β-strand | 1098-1102 | 5 | 14 |
| β-strand | 1105-1110 | 6 | 14 |
| β-strand | 1112 | 1 | 19 |
| β-strand | 1116-1118 | 3 | 18 |
| β-strand | 1129-1130 | 2 | 18 |
| β-strand | 1134 | 1 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Spike glycoprotein | A, B, C | protein | 1283 | Bat coronavirus RaTG13 | A0ABF7PLN6 |
>6ZGF_1 Spike glycoprotein (chains A, B, C) MGILPSPGMPALLSLVSLLSVLLMGCVAETGMFVFLVLLPLVSSQCVNLTTRTQLPPAYT NSSTRGVYYPDKVFRSSVLHLTQDLFLPFFSNVTWFHAIHVSGTNGIKRFDNPVLPFNDG VYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNN KSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTP INLVRDLPPGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGY LQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTDSIVRF PNITNLCPFGEVFNATTFASVYAWNRKRISNCVADYSVLYNSTSFSTFKCYGVSPTKLND LCFTNVYADSFVITGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSKHIDAKEGGNF NYLYRLFRKANLKPFERDISTEIYQAGSKPCNGQTGLNCYYPLYRYGFYPTDGVGHQPYR VVVLSFELLNAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDI ADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQL TPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSRSVASQSII AYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLL LQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPS KRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQY TSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGK IQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDPPEAEVQI DRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFP QSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQ IITTDNTFVSGSCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGIN ASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQSGRENLYFQGGGGSGYIPEAPRDGQ AYVRKDGEWVLLSTFLGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 27 |
SARS-CoV-2 and bat RaTG13 spike glycoprotein structures inform on virus evolution and furin-cleavage effects. Wrobel, A.G., Benton, D.J., Xu, P. et al. Nat Struct Mol Biol (2020) 27:763-767. DOI 10.1038/s41594-020-0468-7 · PubMed
Other PDB entries of the same protein (UniProt A0ABF7PLN6), best resolution first:
MolViewer shows 6ZGF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.