Crystal structure of the c-Src SH3 domain mutant V111L-N113S-T114S at pH 7.0. Determined by X-ray diffraction at 1.31 Å resolution. Released 25 Aug 2021.
Explore 7A35 in 3D Show helices and sheets RCSB PDB PDBe
7A35 contains 1 α-helix and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85-88 | 4 | 1 |
| β-strand | 92 | 1 | 2 |
| β-strand | 99 | 1 | 1 |
| β-strand | 102 | 1 | 2 |
| β-strand | 107-110 | 4 | 1 |
| β-strand | 118-123 | 6 | 1 |
| β-strand | 129-133 | 5 | 1 |
| α-helix | 134-136 | 3 | |
| β-strand | 137-139 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85-88 | 4 | 3 |
| β-strand | 92 | 1 | 4 |
| β-strand | 99 | 1 | 3 |
| β-strand | 102 | 1 | 4 |
| β-strand | 107-109 | 3 | 3 |
| β-strand | 118-123 | 6 | 3 |
| β-strand | 129-133 | 5 | 3 |
| β-strand | 137-139 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Proto-oncogene tyrosine-protein kinase Src | A, B | protein | 60 | Gallus gallus | P00523 (AlphaFold model) |
>7A35_1 Proto-oncogene tyrosine-protein kinase Src (chains A, B) GVTTFVALYDYESRTETDLSFKKGERLQILNSSEGDWWLAHSLTTGQTGYIPSNYVAPSD
Crystal structure of the c-Src SH3 domain mutant V111L-N113S-T114S at pH 7.0. Camara-Artigas, A., Plaza-Garrido, M., Salinas-Garcia, M.C. To be published.
Other PDB entries of the same protein (UniProt P00523 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7A35 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.