Crystal structure of Peptiligase mutant - M222P/L217H/A225N/F189W/N218D. Determined by X-ray diffraction at 2.61 Å resolution. Released 17 Feb 2021.
Explore 7AM7 in 3D Show helices and sheets RCSB PDB PDBe
7AM7 contains 36 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-10 | 4 | |
| α-helix | 14-17 | 4 | |
| β-strand | 27-32 | 6 | 1 |
| β-strand | 46-49 | 4 | 1 |
| α-helix | 64-75 | 12 | |
| β-strand | 89-94 | 6 | 1 |
| α-helix | 104-116 | 13 | |
| β-strand | 121-124 | 4 | 1 |
| β-strand | 128 | 1 | 2 |
| α-helix | 133-144 | 12 | |
| β-strand | 148-152 | 5 | 1 |
| β-strand | 159 | 1 | 3 |
| β-strand | 161-162 | 2 | 3 |
| α-helix | 165-166 | 2 | |
| β-strand | 167 | 1 | 2 |
| β-strand | 175-180 | 6 | 1 |
| α-helix | 185 | 1 | |
| β-strand | 186 | 1 | 1 |
| α-helix | 187 | 1 | |
| β-strand | 198-201 | 4 | 1 |
| β-strand | 205-209 | 5 | 4 |
| β-strand | 213-217 | 5 | 4 |
| α-helix | 220-237 | 18 | |
| α-helix | 243-252 | 10 | |
| β-strand | 255 | 1 | 1 |
| α-helix | 260-263 | 4 | |
| β-strand | 267 | 1 | 1 |
| α-helix | 270-273 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-10 | 4 | |
| α-helix | 14-17 | 4 | |
| β-strand | 27-32 | 6 | 5 |
| β-strand | 46-49 | 4 | 5 |
| α-helix | 64-75 | 12 | |
| β-strand | 89-94 | 6 | 5 |
| β-strand | 101 | 1 | 6 |
| α-helix | 104-116 | 13 | |
| β-strand | 121-124 | 4 | 5 |
| β-strand | 127 | 1 | 6 |
| β-strand | 128 | 1 | 7 |
| α-helix | 133-144 | 12 | |
| β-strand | 148-152 | 5 | 5 |
| β-strand | 159 | 1 | 8 |
| β-strand | 161-162 | 2 | 8 |
| α-helix | 165-166 | 2 | |
| β-strand | 167 | 1 | 7 |
| β-strand | 175-180 | 6 | 5 |
| α-helix | 185 | 1 | |
| β-strand | 186 | 1 | 5 |
| α-helix | 187 | 1 | |
| β-strand | 198-201 | 4 | 5 |
| β-strand | 205-209 | 5 | 9 |
| β-strand | 213-217 | 5 | 9 |
| α-helix | 220-237 | 18 | |
| α-helix | 243-252 | 10 | |
| β-strand | 255 | 1 | 5 |
| α-helix | 260-263 | 4 | |
| β-strand | 267 | 1 | 5 |
| α-helix | 270-275 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-10 | 5 | |
| α-helix | 14-17 | 4 | |
| β-strand | 27-32 | 6 | 10 |
| β-strand | 44-49 | 6 | 10 |
| α-helix | 64-75 | 12 | |
| β-strand | 89-94 | 6 | 10 |
| β-strand | 101 | 1 | 11 |
| α-helix | 104-116 | 13 | |
| β-strand | 121-124 | 4 | 10 |
| β-strand | 126-127 | 2 | 11 |
| β-strand | 128 | 1 | 12 |
| α-helix | 133-144 | 12 | |
| β-strand | 148-152 | 5 | 10 |
| β-strand | 159 | 1 | 13 |
| β-strand | 161-162 | 2 | 13 |
| α-helix | 165-166 | 2 | |
| β-strand | 167 | 1 | 12 |
| β-strand | 175-180 | 6 | 10 |
| α-helix | 185 | 1 | |
| β-strand | 186 | 1 | 10 |
| α-helix | 187 | 1 | |
| β-strand | 198-201 | 4 | 10 |
| β-strand | 205 | 1 | 14 |
| β-strand | 211 | 1 | 6 |
| β-strand | 217 | 1 | 14 |
| α-helix | 220-237 | 18 | |
| α-helix | 243-252 | 10 | |
| β-strand | 255 | 1 | 10 |
| α-helix | 260-263 | 4 | |
| β-strand | 267 | 1 | 10 |
| α-helix | 270-273 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 75-76 | 2 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Subtilisin BPN' | A, C | protein | 272 | Bacillus amyloliquefaciens | P00782 (AlphaFold model) |
| Subtilisin BPN' | B | protein | 272 | Bacillus amyloliquefaciens | P00782 (AlphaFold model) |
| Eglin C fragment | P | protein | 13 | Hirudo medicinalis | P01051 (AlphaFold model) |
>7AM7_1 Subtilisin BPN' (chains A, C) AKCVSYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQD NNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGP SGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPW SSVGPELDVMAPGVSICSTLPGNKYGAHDGTCPASNHVAGAAALILSKHPNWTNTQVRSS LENTATKLGDSFYYGKGLINVEAAAQHHHHHH
>7AM7_2 Subtilisin BPN' (chains B) AKCVSYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVAGGASFVPSETNPFQD NNSHGTHVAGTVLAVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGP SGSAALKAAVDKAVASGVVVVAAAGNSGTSGSSSTVSYPAKYPSVIAVGAVDSSNQRAPW SSVGPELDVMAPGVSICSTLPGNKYGAHDGTCPASNHVAGAAALILSKHPNWTNTQVRSS LENTATKLGDSFYYGKGLINVEAAAQHHHHHH
>7AM7_3 Eglin C fragment (chains P) LPEGSPVTLDLRY
From thiol-subtilisin to omniligase: Design and structure of a broadly applicable peptide ligase. Toplak, A., Teixeira de Oliveira, E.F., Schmidt, M. et al. Comput Struct Biotechnol J (2021) 19:1277-1287. DOI 10.1016/j.csbj.2021.02.002 · PubMed
Other PDB entries of the same protein (UniProt P00782 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7AM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.