7B90: PDB entry 7B90
Circular permutant of ribosomal protein S6, P54-55 truncated, I8A mutant. Determined by X-ray diffraction at 2.05 Å resolution. Released 8 Jun 2022.
- Method
- X-ray diffraction
- Resolution
- 2.05 Å
- Organism
- Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
- Chains
- 12
- Atoms
- 8,572
- Mol. weight
- 121.07 kDa
- Released
- 8 Jun 2022
Explore 7B90 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7B90 contains 43 α-helices and 48 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-24 | 9 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| α-helix | 74 | 1 | |
| β-strand | 75-83 | 9 | 1 |
Chain B: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-25 | 13 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
Chain C: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-24 | 9 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| α-helix | 74 | 1 | |
| β-strand | 75-82 | 8 | 1 |
Chain D: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-10 | 8 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-24 | 9 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
Chains E and L: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-25 | 10 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
Chain F: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-24 | 9 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| α-helix | 74 | 1 | |
| β-strand | 75-83 | 9 | 1 |
Chains G and J: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-25 | 10 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
Chain H: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-23 | 8 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 30S ribosomal protein S6,30S ribosomal protein S6 | A, B, C, D, E, F, G, H, I, J, K, L | protein | 86 | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) | Q5SLP8 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA
>7B90_1 30S ribosomal protein S6,30S ribosomal protein S6 (chains A, B, C, D, E, F, G, H, I, J, K, L)
MQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNAVLNPNLDQSQLA
LEKEIIQRALENYGARVEKVEELGLR
Primary citation
Circular permutant of ribosomal protein S6, P54-55 truncate, I8A. Wang, H., Logan, D.T., Oliveberg, M. To be published.
Other PDB entries of the same protein (UniProt Q5SLP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3ZZP 0.96 Å, Circular permutant of ribosomal protein S6, lacking edge strand beta- 2 of wild-type S6.
- 6I69 1.2 Å, Circular permutant of ribosomal protein S6, adding 5aa to C terminal of P97-3, L10A mutant
- 6I6E 1.2 Å, Circular permutant of ribosomal protein S6, swap strand 1 , L10A mutant
- 6I6S 1.46 Å, Circular permutant of ribosomal protein S6, adding 9aa to C terminal of P68-69, L75A…
- 6I6W 1.49 Å, Circular permutant of ribosomal protein S6, adding 6aa to C terminal of P68-69
- 6I6I 1.5 Å, Circular permutant of ribosomal protein S6, adding 6aa to C terminal of P68-69, L75A…
- 6I6U 1.57 Å, Circular permutant of ribosomal protein S6, adding 9aa to N terminal of P81-82, L75A…
- 1CQM 1.65 Å, Protein aggregation and alzheimer's disease: crystallographic analysis of the…
- 7OS7 1.65 Å, Circular permutant of ribosomal protein S6, swap helix 2, L75A, A92K mutant
- 7BFF 1.66 Å, Circular permutant of ribosomal protein S6, P54-55 truncated, I25A mutant.
- 7B8V 1.86 Å, Circular permutant of ribosomal protein S6, P54-55
- 6I6O 1.9 Å, Circular permutant of ribosomal protein S6, swap helix 2, L75A mutant
Browse structure collections
About this viewer
MolViewer shows 7B90 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.