Circular permutant of ribosomal protein S6, P54-55 truncated, I25A mutant. Determined by X-ray diffraction at 1.66 Å resolution. Released 13 Jul 2022.
Explore 7BFF in 3D Show helices and sheets RCSB PDB PDBe
7BFF contains 22 α-helices and 24 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-10 | 8 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-25 | 10 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| α-helix | 74 | 1 | |
| β-strand | 75-82 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-24 | 12 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 50 | 1 | |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-24 | 9 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 50 | 1 | |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-25 | 13 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| α-helix | 74 | 1 | |
| β-strand | 75-83 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 13-15 | 3 | |
| α-helix | 16-24 | 9 | |
| β-strand | 29-36 | 8 | 1 |
| β-strand | 42-49 | 8 | 1 |
| α-helix | 55-71 | 17 | |
| β-strand | 75-83 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 30S ribosomal protein S6,30S ribosomal protein S6 | A, B, C, D, E, F | protein | 86 | Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) | Q5SLP8 (AlphaFold model) |
>7BFF_1 30S ribosomal protein S6,30S ribosomal protein S6 (chains A, B, C, D, E, F) MQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVASTTPGRYEVNIVLNPNLDQSQLA LEKEAIQRALENYGARVEKVEELGLR
Circular permutant of ribosomal protein S6. Wang, H., Logan, D.T., Oliveberg, M. To be published.
Other PDB entries of the same protein (UniProt Q5SLP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7BFF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.