Crystal structure of Atg40 AIM fused to Atg8. Determined by X-ray diffraction at 2.23 Å resolution. Released 8 Jul 2020.
Explore 7BRN in 3D Show helices and sheets RCSB PDB PDBe
7BRN contains 9 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-3 | 2 | |
| α-helix | 12-14 | 3 | |
| α-helix | 17-19 | 3 | |
| α-helix | 23-26 | 4 | |
| α-helix | 29-42 | 14 | |
| β-strand | 46-53 | 8 | 1 |
| α-helix | 54 | 1 | |
| β-strand | 57 | 1 | 2 |
| β-strand | 66-70 | 5 | 1 |
| β-strand | 74 | 1 | 3 |
| α-helix | 75-85 | 11 | |
| β-strand | 95-97 | 3 | 1 |
| β-strand | 98 | 1 | 4 |
| β-strand | 101 | 1 | 4 |
| β-strand | 108 | 1 | 3 |
| α-helix | 109-116 | 8 | |
| α-helix | 122 | 1 | |
| β-strand | 123-128 | 6 | 1 |
| β-strand | 132 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Autophagy-related protein 40,Autophagy-related protein 8 | A | protein | 134 | Saccharomyces cerevisiae S288C | P38182 (AlphaFold model), Q99325 (AlphaFold model) |
>7BRN_1 Autophagy-related protein 40,Autophagy-related protein 8 (chains A) GPEFPNDYDFMEDILDETMKSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIP EIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKD GFLYVTYSGENTFG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ALE | L-epinephrine | C9 H13 N O3 | 1 |
Water and common crystallization additives (EDO) are not listed.
Super-assembly of ER-phagy receptor Atg40 induces local ER remodeling at contacts with forming autophagosomal membranes. Mochida, K., Yamasaki, A., Matoba, K. et al. Nat Commun (2020) 11:3306-3306. DOI 10.1038/s41467-020-17163-y · PubMed
Other PDB entries of the same protein (UniProt P38182 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7BRN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.