Crystal structure of the N-terminal domain of human MdmX protein in complex with Nutlin3a. Determined by X-ray diffraction at 1.63 Å resolution. Released 17 Jun 2020.
Explore 7C3Y in 3D Show helices and sheets RCSB PDB PDBe
7C3Y contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-18 | 6 | |
| β-strand | 25-26 | 2 | 1 |
| β-strand | 27-28 | 2 | 2 |
| α-helix | 30-38 | 9 | |
| β-strand | 46-47 | 2 | 1 |
| α-helix | 48-61 | 14 | |
| β-strand | 65 | 1 | 3 |
| β-strand | 72-73 | 2 | 3 |
| α-helix | 79-84 | 6 | |
| β-strand | 89-90 | 2 | 3 |
| α-helix | 95-104 | 10 | |
| β-strand | 105-106 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein Mdm4 | A | protein | 96 | Homo sapiens | O15151 (AlphaFold model) |
>7C3Y_1 Protein Mdm4 (chains A) DLENLYFQGSQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH MVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVT
| ID | Name | Formula | Copies |
|---|---|---|---|
| O4B | 1,4,7,10,13,16-hexaoxacyclooctadecane | C12 H24 O6 | 1 |
| NUT | 4-({(4S,5R)-4,5-bis(4-chlorophenyl)-2-[4-methoxy-2-(propan-2-yloxy)phenyl]-4,5-… | C30 H30 Cl2 N4 O4 | 1 |
Crystal structure of the N-terminal domain of human MdmX protein in complex with Nutlin3a. Su, Z.D., Cheng, X.Y., Zhang, B.L. et al. To be published.
Other PDB entries of the same protein (UniProt O15151 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7C3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.