7C7X: Histone H2A.6
Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1). Determined by X-ray diffraction at 3.0 Å resolution. Released 11 Nov 2020.
- Method
- X-ray diffraction
- Resolution
- 3.0 Å
- Organism
- Arabidopsis thaliana
- Chains
- 6
- Atoms
- 5,502
- Mol. weight
- 97.47 kDa
- Released
- 11 Nov 2020
Explore 7C7X in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
7C7X contains 34 α-helices and 18 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-36 | 10 | |
| α-helix | 46-66 | 21 | |
| α-helix | 69-72 | 4 | |
| β-strand | 77-78 | 2 | 7 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-97 | 7 | |
Chain B: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62-72 | 11 | |
| β-strand | 77-78 | 2 | 7 |
| α-helix | 80-107 | 28 | |
| α-helix | 115-125 | 11 | |
| α-helix | 128-146 | 19 | |
Chain C: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-36 | 10 | |
| α-helix | 46-62 | 17 | |
| α-helix | 66-72 | 7 | |
| β-strand | 77-78 | 2 | 1 |
| α-helix | 80-89 | 10 | |
| α-helix | 91-97 | 7 | |
Chain D: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 62-72 | 11 | |
| β-strand | 77-78 | 2 | 1 |
| α-helix | 80-107 | 28 | |
| α-helix | 115-125 | 11 | |
| α-helix | 128-143 | 16 | |
Chain E: 8 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-74 | 56 | |
| α-helix | 80-87 | 8 | |
| α-helix | 89-92 | 4 | |
| α-helix | 97-102 | 6 | |
| α-helix | 103-105 | 3 | |
| β-strand | 113 | 1 | 2 |
| β-strand | 120-121 | 2 | 2 |
| β-strand | 125-126 | 2 | 3 |
| β-strand | 133 | 1 | 4 |
| β-strand | 137-138 | 2 | 3 |
| β-strand | 140-143 | 4 | 2 |
| β-strand | 151-154 | 4 | 2 |
| β-strand | 159 | 1 | 4 |
| α-helix | 187-190 | 4 | |
| α-helix | 208-210 | 3 | |
| α-helix | 211-215 | 5 | |
Chain F: 8 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-74 | 53 | |
| α-helix | 80-87 | 8 | |
| α-helix | 97-102 | 6 | |
| α-helix | 103-105 | 3 | |
| β-strand | 109-113 | 5 | 5 |
| β-strand | 120-125 | 6 | 5 |
| β-strand | 133 | 1 | 6 |
| β-strand | 140-143 | 4 | 5 |
| β-strand | 152-154 | 3 | 5 |
| α-helix | 155-157 | 3 | |
| β-strand | 159 | 1 | 6 |
| α-helix | 207-210 | 4 | |
| α-helix | 211-216 | 6 | |
| α-helix | 220-223 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H2A.6 | A, C | protein | 93 | Arabidopsis thaliana | Q9LD28 (AlphaFold model) |
| Histone H2B.1 | B, D | protein | 98 | Arabidopsis thaliana | Q9LQQ4 (AlphaFold model) |
| NAP1-related protein 1 | E, F | protein | 239 | Arabidopsis thaliana | Q9CA59 (AlphaFold model) |
Sequence of entity 1 (A, C), FASTA
>7C7X_1 Histone H2A.6 (chains A, C)
KKATSRSSKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLAAVLEYLAAEVLELAGNAAR
DNKKTRIVPRHIQLAVRNDEELSKLLGDVTIAN
Sequence of entity 2 (B, D), FASTA
>7C7X_2 Histone H2B.1 (chains B, D)
KKRSKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKK
PTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sequence of entity 3 (E, F), FASTA
>7C7X_3 NAP1-related protein 1 (chains E, F)
SNLEQIDAELVLSIEKLQEIQDDLEKINEKASDEVLEVEQKYNVIRKPVYDKRNEVIQSI
PGFWMTAFLSHPALGDLLTEEDQKIFKYLNSLEVEDAKDVKSGYSITFHFTSNPFFEDAK
LTKTFTFLEEGTTKITATPIKWKEGKGLPNGVNHDDKKGNKRALPEESFFTWFTDAQHKE
DAGDEIHDEVADIIKEDLWSNPLTYFNNDADEEDFDGDDDGDEEGEEDDDDEEEEDGEE
Primary citation
NAP1-Related Protein 1 (NRP1) has multiple interaction modes for chaperoning histones H2A-H2B. Luo, Q., Wang, B., Wu, Z. et al. Proc Natl Acad Sci U S A (2020) 117:30391-30399. DOI 10.1073/pnas.2011089117 · PubMed
Other PDB entries of the same protein (UniProt Q9LD28 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7BP2 1.58 Å, Structural mechanism directing nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
- 7BP6 1.58 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
- 7BP5 1.9 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
- 7BP4 2.1 Å, Structural insights into nucleosome reorganization by NAP1-RELATED PROTEIN 1 (NRP1)
- 9K42 3.14 Å, Cryo-EM structure of Arabidopsis thaliana H2A-nucleosome with 147bp Widom 601 DNA (C2…
- 9K40 3.15 Å, Cryo-EM structure of Arabidopsis thaliana H2A-nucleosome with Arabidopsis native 147bp…
- 8KCB 3.17 Å, Complex of DDM1-nucleosome(H2A) complex with DDM1 bound to SHL2
- 8WHB 3.17 Å, Structure of nucleosome core particle of Arabidopsis thaliana
- 9K44 3.22 Å, Cryo-EM structure of Arabidopsis thaliana H2A-H3.3-nucleosome with Arabidopsis native…
- 8WH9 3.31 Å, Structure of DDM1-nucleosome complex in ADP-BeFx state
- 8WH5 3.58 Å, Structure of DDM1-nucleosome complex in the apo state
- 8WH8 3.6 Å, Structure of DDM1-nucleosome complex in ADP state
Browse structure collections
About this viewer
MolViewer shows 7C7X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.