7D2G: Coiled-coil structure of liprin-alpha2_H2delC

Coiled-coil structure of liprin-alpha2_H2delC. Determined by X-ray diffraction at 1.7 Å resolution. Released 7 Apr 2021.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,743
Mol. weight: 25.9 kDa
Released: 7 Apr 2021

Explore 7D2G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D2G contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	102-147	46

Chains B and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	98-145	48

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	100-144	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Liprin-alpha-2	A, B, C, D	protein	55	Homo sapiens	O75334 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7D2G_1 Liprin-alpha-2 (chains A, B, C, D)
GPGSEFEFAAMTKELNACREQLLEKEEEISELKAERNNTRLLLEHLEALVSRHER

Primary citation

Oligomerized liprin-alpha promotes phase separation of ELKS for compartmentalization of presynaptic active zone proteins. Liang, M., Jin, G., Xie, X. et al. Cell Rep (2021) 34:108901-108901. DOI 10.1016/j.celrep.2021.108901 · PubMed

Other PDB entries of the same protein (UniProt O75334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D2E 1.7 Å, Tetrameric coiled-coil structure of liprin-alpha2_H3
6IUH 1.8 Å, Crystal structure of GIT1 PBD domain in complex with Liprin-alpha2
3TAC 2.2 Å, Crystal Structure of the Liprin-alpha/CASK complex
7D2H 2.2 Å, Tetrameric coiled-coil structure of liprin-alpha2_H2
8Z22 2.75 Å, Crystal structure of the liprin-alpha2/RIM1 complex
3TAD 2.9 Å, Crystal Structure of the Liprin-alpha/Liprin-beta complex

Browse structure collections

About this viewer

MolViewer shows 7D2G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.