7D6F: ARMS-PBM/MAGI2-PDZ4

The crystal structure of ARMS-PBM/MAGI2-PDZ4. Determined by X-ray diffraction at 3.0 Å resolution. Released 4 Nov 2020.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Mus musculus, Rattus norvegicus
Chains: 2
Atoms: 666
Mol. weight: 12.81 kDa
Released: 4 Nov 2020

Explore 7D6F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7D6F contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	918-923	6	1
β-strand	932-936	5	2
β-strand	952-956	5	2
α-helix	961-965	5
α-helix	972	1
β-strand	973	1	2
α-helix	974	1
β-strand	976-977	2	1
β-strand	981	1	1
α-helix	987-995	9
β-strand	1000-1005	6	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1758-1761	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2	A	protein	101	Mus musculus	Q9WVQ1 (AlphaFold model)
Kinase D-interacting substrate of 220 kDa	B	protein	19	Rattus norvegicus	Q9EQG6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7D6F_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (chains A)
GPGSSLQTSDVVIHRKENEGFGFVIISSLNRPESGATITVPHKIGRIIDGSPADRCAKLK
VGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEE

Sequence of entity 2 (B), FASTA

>7D6F_2 Kinase D-interacting substrate of 220 kDa (chains B)
GPGSSSESTGFGEERESIL

Primary citation

Crystal structure of the PDZ4 domain of MAGI2 in complex with PBM of ARMS reveals a canonical PDZ recognition mode. Zhang, Y., Zhong, Z., Ye, J. et al. Neurochem Int (2021) 149:105152-105152. DOI 10.1016/j.neuint.2021.105152 · PubMed

Other PDB entries of the same protein (UniProt Q9WVQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JJZ 1.65 Å, Crystal Structure of MAGI2 and Dendrin complex
7YKI 2.0 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR3 peptide
6KKG 2.15 Å, Crystal structure of MAGI2-Dendrin complex
7YKG 2.16 Å, Crystal structure of MAGI2 PDZ0-GK/pSGEF complex
7YKF 2.28 Å, Crystal structure of MAGI2 PDZ0-GK/pEphexin4 complex
7YKH 2.5 Å, Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR2 peptide

Browse structure collections

About this viewer

MolViewer shows 7D6F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.