Crystal structure of MAGI2 PDZ0-GK domain in complex with phospho-SAPAP1 GBR2 peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 Aug 2023.
Explore 7YKH in 3D Show helices and sheets RCSB PDB PDBe
7YKH contains 25 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-21 | 6 | 1 |
| α-helix | 24-26 | 3 | |
| β-strand | 32-34 | 3 | 1 |
| α-helix | 36-38 | 3 | |
| β-strand | 40 | 1 | 2 |
| β-strand | 42-44 | 3 | 1 |
| α-helix | 49-51 | 3 | |
| β-strand | 53-57 | 5 | 1 |
| α-helix | 64 | 1 | |
| β-strand | 65-69 | 5 | 1 |
| β-strand | 72-73 | 2 | 1 |
| α-helix | 79-87 | 9 | |
| α-helix | 90 | 1 | |
| β-strand | 93-98 | 6 | 1 |
| β-strand | 101 | 1 | 3 |
| β-strand | 104 | 1 | 3 |
| β-strand | 107 | 1 | 2 |
| α-helix | 108-113 | 6 | |
| α-helix | 116-117 | 2 | |
| α-helix | 121-135 | 15 | |
| β-strand | 140-141 | 2 | 4 |
| β-strand | 151 | 1 | 5 |
| β-strand | 155 | 1 | 5 |
| β-strand | 156-157 | 2 | 4 |
| α-helix | 160-168 | 9 | |
| β-strand | 172-177 | 6 | 4 |
| β-strand | 182-186 | 5 | 4 |
| α-helix | 187-190 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -1-5 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-21 | 6 | 6 |
| α-helix | 24-26 | 3 | |
| β-strand | 32-34 | 3 | 6 |
| α-helix | 36-38 | 3 | |
| β-strand | 40 | 1 | 7 |
| β-strand | 42-44 | 3 | 6 |
| β-strand | 53-57 | 5 | 6 |
| α-helix | 64 | 1 | |
| β-strand | 65-69 | 5 | 6 |
| β-strand | 72-73 | 2 | 6 |
| α-helix | 79-87 | 9 | |
| α-helix | 90 | 1 | |
| β-strand | 93-98 | 6 | 6 |
| β-strand | 101 | 1 | 8 |
| β-strand | 104 | 1 | 8 |
| β-strand | 107 | 1 | 7 |
| α-helix | 108-113 | 6 | |
| α-helix | 116-117 | 2 | |
| α-helix | 121-135 | 15 | |
| β-strand | 140-141 | 2 | 9 |
| α-helix | 144-145 | 2 | |
| α-helix | 149-150 | 2 | |
| β-strand | 151 | 1 | 10 |
| β-strand | 155 | 1 | 10 |
| β-strand | 156-157 | 2 | 9 |
| α-helix | 160-168 | 9 | |
| β-strand | 172-178 | 7 | 9 |
| β-strand | 181-186 | 6 | 9 |
| α-helix | 187-189 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 | A, C | protein | 234 | Mus musculus | Q9WVQ1 (AlphaFold model) |
| SAPAP1 | B, D | protein | 14 | Mus musculus | Q9D415 (AlphaFold model) |
>7YKH_1 Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 (chains A, C) GPGSSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKLVSEE LLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGSVDHE LQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEEFMELEKSGALLESGTYEDNYYG TPKPPAEPAPLLNVTDQILPGATPSAEGKRKRNKSVTNMEKASIEPPEEEEEER
>7YKH_2 SAPAP1 (chains B, D) ARRESYLKATQPSL
Phosphorylation-dependent recognition of diverse protein targets by the cryptic GK domain of MAGI MAGUKs. Zhang, M., Cao, A., Lin, L. et al. Sci Adv (2023) 9:eadf3295-eadf3295. DOI 10.1126/sciadv.adf3295 · PubMed
Other PDB entries of the same protein (UniProt Q9WVQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7YKH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.